Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XZU7

Protein Details
Accession A0A1Y1XZU7    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
125-144ANLPKRRLPKAPKAVRKPDTHydrophilic
NLS Segment(s)
PositionSequence
129-142KRRLPKAPKAVRKP
189-189K
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSSAFTAANRRKRIATYGKPSRPSANFDWNVEDAPSPERPRKQVGALAGALKRPGTTAGGGAISAGRRLTPPKPKATRDVFDVPSEDELAAPTSSLPSPTRTKKVSPKQAAPLDDFDVPYSSEEANLPKRRLPKAPKAVRKPDTQRPVVPSIKRIPLDERSDIYSSEDPLAAPPRPRAKAAQILQKPSKGGQLKPQAEQRPVAKPKAPSRAITPAATTSSTLEKPKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.59
3 0.61
4 0.67
5 0.72
6 0.74
7 0.74
8 0.72
9 0.65
10 0.62
11 0.58
12 0.57
13 0.53
14 0.49
15 0.51
16 0.44
17 0.41
18 0.35
19 0.29
20 0.19
21 0.2
22 0.24
23 0.24
24 0.3
25 0.34
26 0.37
27 0.43
28 0.45
29 0.45
30 0.44
31 0.42
32 0.4
33 0.37
34 0.37
35 0.32
36 0.29
37 0.26
38 0.22
39 0.18
40 0.14
41 0.14
42 0.11
43 0.1
44 0.1
45 0.1
46 0.11
47 0.1
48 0.1
49 0.1
50 0.08
51 0.08
52 0.07
53 0.06
54 0.07
55 0.12
56 0.18
57 0.27
58 0.33
59 0.42
60 0.5
61 0.53
62 0.6
63 0.63
64 0.59
65 0.55
66 0.56
67 0.48
68 0.42
69 0.4
70 0.32
71 0.26
72 0.24
73 0.17
74 0.11
75 0.09
76 0.09
77 0.08
78 0.07
79 0.06
80 0.06
81 0.06
82 0.09
83 0.09
84 0.12
85 0.18
86 0.23
87 0.28
88 0.29
89 0.35
90 0.43
91 0.52
92 0.59
93 0.59
94 0.59
95 0.62
96 0.64
97 0.6
98 0.52
99 0.44
100 0.36
101 0.3
102 0.26
103 0.18
104 0.14
105 0.12
106 0.1
107 0.1
108 0.07
109 0.07
110 0.08
111 0.11
112 0.18
113 0.23
114 0.23
115 0.25
116 0.31
117 0.34
118 0.42
119 0.46
120 0.49
121 0.55
122 0.64
123 0.7
124 0.74
125 0.8
126 0.76
127 0.77
128 0.74
129 0.72
130 0.7
131 0.65
132 0.6
133 0.55
134 0.58
135 0.56
136 0.5
137 0.46
138 0.44
139 0.46
140 0.43
141 0.4
142 0.38
143 0.38
144 0.42
145 0.39
146 0.35
147 0.33
148 0.33
149 0.32
150 0.31
151 0.25
152 0.21
153 0.19
154 0.18
155 0.14
156 0.15
157 0.19
158 0.17
159 0.18
160 0.24
161 0.3
162 0.32
163 0.35
164 0.36
165 0.39
166 0.46
167 0.49
168 0.53
169 0.51
170 0.57
171 0.59
172 0.57
173 0.53
174 0.44
175 0.47
176 0.41
177 0.39
178 0.4
179 0.47
180 0.48
181 0.52
182 0.6
183 0.57
184 0.56
185 0.58
186 0.53
187 0.53
188 0.55
189 0.55
190 0.51
191 0.53
192 0.58
193 0.64
194 0.63
195 0.55
196 0.56
197 0.6
198 0.59
199 0.52
200 0.46
201 0.39
202 0.38
203 0.36
204 0.3
205 0.23
206 0.25
207 0.27
208 0.28