Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1ZJD6

Protein Details
Accession A0A1Y1ZJD6    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
55-79AHTGIQTRRKPKKRFIHSRHPITSSHydrophilic
NLS Segment(s)
PositionSequence
62-68RRKPKKR
Subcellular Location(s) mito 11, nucl 7, extr 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MLTLRHTLFHYRSVLFWFLAAAPASLNRPPPLLKTTSYVRRDSHTHRSSDRNPYAHTGIQTRRKPKKRFIHSRHPITSSQLVYVRASEAKARTPCP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.22
4 0.18
5 0.14
6 0.15
7 0.14
8 0.1
9 0.08
10 0.09
11 0.12
12 0.12
13 0.14
14 0.13
15 0.14
16 0.15
17 0.18
18 0.2
19 0.21
20 0.21
21 0.22
22 0.28
23 0.36
24 0.39
25 0.39
26 0.37
27 0.38
28 0.41
29 0.44
30 0.48
31 0.42
32 0.42
33 0.41
34 0.47
35 0.49
36 0.54
37 0.52
38 0.44
39 0.41
40 0.42
41 0.41
42 0.36
43 0.32
44 0.28
45 0.3
46 0.38
47 0.42
48 0.49
49 0.56
50 0.65
51 0.7
52 0.74
53 0.78
54 0.8
55 0.85
56 0.84
57 0.85
58 0.85
59 0.89
60 0.83
61 0.77
62 0.67
63 0.61
64 0.59
65 0.48
66 0.42
67 0.36
68 0.32
69 0.29
70 0.28
71 0.25
72 0.2
73 0.21
74 0.22
75 0.21
76 0.28