Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2A0F4

Protein Details
Accession A0A1Y2A0F4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
51-70IEARDPKKSKPKTSNNGNTTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, plas 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MKFLAVTLLFATSALALANPAPAPVDAAAVAAPEVDARTAGIKLEARGITIEARDPKKSKPKTSNNGNTTDNAAGILTPSRMLELGALGLGVVEVVRLWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.05
5 0.06
6 0.06
7 0.06
8 0.07
9 0.07
10 0.08
11 0.08
12 0.08
13 0.07
14 0.07
15 0.07
16 0.06
17 0.06
18 0.04
19 0.04
20 0.03
21 0.04
22 0.03
23 0.03
24 0.04
25 0.05
26 0.05
27 0.05
28 0.07
29 0.08
30 0.08
31 0.12
32 0.12
33 0.11
34 0.11
35 0.12
36 0.11
37 0.1
38 0.12
39 0.14
40 0.16
41 0.19
42 0.21
43 0.26
44 0.36
45 0.42
46 0.49
47 0.54
48 0.62
49 0.68
50 0.77
51 0.82
52 0.76
53 0.74
54 0.67
55 0.57
56 0.5
57 0.41
58 0.3
59 0.2
60 0.16
61 0.1
62 0.09
63 0.09
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.07
70 0.07
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.04
77 0.04
78 0.03
79 0.03
80 0.02