Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1ZPR1

Protein Details
Accession A0A1Y1ZPR1    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
73-100SHSPDPPCRPHPKKERRTNTPKISHQSDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 11.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MKYFTILHKCCCYSCKQFQSTFTPLAIRICHVLRQKTIRFRVLSVLGRHEVPASSCTFRWHASSPLAHQHYPSHSPDPPCRPHPKKERRTNTPKISHQSDPQQAQVRQSSASYDCGKRAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.55
4 0.57
5 0.6
6 0.65
7 0.62
8 0.55
9 0.46
10 0.38
11 0.33
12 0.32
13 0.27
14 0.2
15 0.18
16 0.17
17 0.22
18 0.26
19 0.29
20 0.31
21 0.39
22 0.44
23 0.5
24 0.54
25 0.54
26 0.5
27 0.47
28 0.46
29 0.44
30 0.43
31 0.35
32 0.34
33 0.29
34 0.28
35 0.27
36 0.23
37 0.17
38 0.13
39 0.13
40 0.12
41 0.12
42 0.12
43 0.14
44 0.15
45 0.16
46 0.18
47 0.18
48 0.18
49 0.19
50 0.2
51 0.2
52 0.26
53 0.28
54 0.26
55 0.25
56 0.25
57 0.26
58 0.28
59 0.3
60 0.26
61 0.26
62 0.3
63 0.36
64 0.42
65 0.44
66 0.47
67 0.54
68 0.55
69 0.62
70 0.69
71 0.73
72 0.76
73 0.82
74 0.85
75 0.85
76 0.9
77 0.91
78 0.9
79 0.88
80 0.85
81 0.82
82 0.77
83 0.71
84 0.67
85 0.66
86 0.64
87 0.57
88 0.56
89 0.57
90 0.53
91 0.54
92 0.52
93 0.44
94 0.37
95 0.35
96 0.32
97 0.25
98 0.3
99 0.31
100 0.29