Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1YT07

Protein Details
Accession A0A1Y1YT07    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-45TQPTQPTQPTQRNRRRETRRESPESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR041898  MAGE_WH1  
IPR002190  MHD_dom  
Pfam View protein in Pfam  
PF01454  MAGE  
Amino Acid Sequences MPPTSRKRRAPVDEDEVSTPTQPTQPTQPTQRNRRRETRRESPESEEGDGDEEEEASGSSSIAQLSKSLVRYALACEYARVPIKRQDISQKGTTLVKGLMVHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.56
3 0.47
4 0.39
5 0.33
6 0.25
7 0.18
8 0.17
9 0.15
10 0.16
11 0.22
12 0.27
13 0.31
14 0.4
15 0.48
16 0.54
17 0.64
18 0.72
19 0.74
20 0.75
21 0.8
22 0.82
23 0.82
24 0.82
25 0.81
26 0.81
27 0.78
28 0.75
29 0.71
30 0.66
31 0.59
32 0.51
33 0.4
34 0.31
35 0.25
36 0.21
37 0.15
38 0.09
39 0.06
40 0.05
41 0.05
42 0.05
43 0.03
44 0.04
45 0.03
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.07
53 0.1
54 0.11
55 0.11
56 0.11
57 0.11
58 0.12
59 0.14
60 0.15
61 0.15
62 0.15
63 0.15
64 0.16
65 0.2
66 0.25
67 0.24
68 0.25
69 0.3
70 0.36
71 0.38
72 0.41
73 0.47
74 0.48
75 0.53
76 0.54
77 0.48
78 0.45
79 0.45
80 0.41
81 0.33
82 0.27
83 0.24