Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2AC64

Protein Details
Accession A0A1Y2AC64   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VAAKKHVPIVKKHPKRFNRHQSDRFKCVDPSWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
11-18VKKHPKRF
34-52RKPKGIDNRVRRRFKGQAA
Subcellular Location(s) mito 19.5, mito_nucl 12.333, cyto_nucl 4.333, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKHPKRFNRHQSDRFKCVDPSWRKPKGIDNRVRRRFKGQAAMPKIGYGSNKKTRHLMPSGHKAFLVNNTRDVDLLLMHNNTFAAEISHAVSSRKRIEIVTRAKQLGVKVTNGHAKVKTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.86
4 0.9
5 0.9
6 0.9
7 0.9
8 0.9
9 0.91
10 0.89
11 0.86
12 0.78
13 0.7
14 0.61
15 0.54
16 0.55
17 0.52
18 0.54
19 0.58
20 0.61
21 0.59
22 0.59
23 0.65
24 0.65
25 0.67
26 0.67
27 0.68
28 0.72
29 0.8
30 0.84
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.58
37 0.58
38 0.57
39 0.57
40 0.5
41 0.43
42 0.38
43 0.3
44 0.27
45 0.22
46 0.24
47 0.31
48 0.33
49 0.34
50 0.37
51 0.38
52 0.41
53 0.4
54 0.39
55 0.36
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.31
62 0.33
63 0.34
64 0.24
65 0.25
66 0.26
67 0.26
68 0.26
69 0.25
70 0.18
71 0.11
72 0.12
73 0.1
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.08
80 0.07
81 0.06
82 0.06
83 0.07
84 0.08
85 0.09
86 0.1
87 0.11
88 0.13
89 0.17
90 0.21
91 0.22
92 0.22
93 0.23
94 0.29
95 0.37
96 0.45
97 0.48
98 0.5
99 0.49
100 0.49
101 0.5
102 0.45
103 0.45
104 0.38
105 0.32
106 0.28
107 0.33
108 0.39
109 0.39
110 0.42
111 0.36