Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1YJA9

Protein Details
Accession A0A1Y1YJA9   
Localization Confidence Low
Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
88-108IQAAHARHRHHRRTPSRPATPBasic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 8, mito 6, cysk 5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013922  Cyclin_PHO80-like  
Gene Ontology GO:0019901  F:protein kinase binding  
GO:0000079  P:regulation of cyclin-dependent protein serine/threonine kinase activity  
Pfam View protein in Pfam  
PF08613  Cyclin  
Amino Acid Sequences MSSDIPTPPSAPNPASDAGVLPEFRPVSLDNIPSPPPDFDWDIMSMEADTAMRLVFTAVHDLALANGDVPPTPAITRPETPSKYTAVIQAAHARHRHHRRTPSRPATPIPEERSYVDPDPIEPPEASSDEPITTNTGQIGTESEPSTEEIANLARKFYSKHVPNVSLEKYSLRMQTYCPMTTPVWLGAGAYIYRMCCVDKRVPLTERTMHRVLLASLVTAMKALEDHRWHHGRFAKVGGVEAKSLTRVELAVIYLTGGHLQFLNPDDLRDAVVGLQKAARDATQANQLAATFNLALPTPKNSLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.25
4 0.21
5 0.18
6 0.2
7 0.19
8 0.15
9 0.19
10 0.18
11 0.17
12 0.18
13 0.17
14 0.2
15 0.24
16 0.26
17 0.24
18 0.27
19 0.29
20 0.28
21 0.3
22 0.25
23 0.23
24 0.25
25 0.25
26 0.22
27 0.24
28 0.23
29 0.23
30 0.21
31 0.19
32 0.15
33 0.11
34 0.11
35 0.08
36 0.06
37 0.05
38 0.05
39 0.04
40 0.04
41 0.05
42 0.05
43 0.06
44 0.1
45 0.1
46 0.1
47 0.11
48 0.11
49 0.1
50 0.1
51 0.09
52 0.05
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.08
60 0.11
61 0.15
62 0.19
63 0.22
64 0.26
65 0.35
66 0.36
67 0.39
68 0.38
69 0.36
70 0.34
71 0.32
72 0.32
73 0.25
74 0.23
75 0.22
76 0.27
77 0.27
78 0.29
79 0.31
80 0.3
81 0.37
82 0.46
83 0.53
84 0.54
85 0.63
86 0.69
87 0.75
88 0.83
89 0.83
90 0.8
91 0.75
92 0.7
93 0.66
94 0.63
95 0.6
96 0.54
97 0.47
98 0.42
99 0.4
100 0.39
101 0.36
102 0.31
103 0.26
104 0.2
105 0.19
106 0.2
107 0.19
108 0.18
109 0.13
110 0.13
111 0.13
112 0.14
113 0.13
114 0.11
115 0.11
116 0.1
117 0.11
118 0.1
119 0.11
120 0.1
121 0.1
122 0.09
123 0.09
124 0.08
125 0.08
126 0.09
127 0.07
128 0.09
129 0.09
130 0.09
131 0.09
132 0.1
133 0.11
134 0.1
135 0.09
136 0.07
137 0.09
138 0.11
139 0.11
140 0.1
141 0.09
142 0.1
143 0.11
144 0.14
145 0.22
146 0.22
147 0.29
148 0.33
149 0.35
150 0.37
151 0.41
152 0.39
153 0.31
154 0.28
155 0.22
156 0.21
157 0.21
158 0.21
159 0.18
160 0.17
161 0.17
162 0.22
163 0.25
164 0.23
165 0.21
166 0.21
167 0.2
168 0.21
169 0.2
170 0.15
171 0.12
172 0.11
173 0.11
174 0.07
175 0.08
176 0.07
177 0.06
178 0.07
179 0.06
180 0.07
181 0.07
182 0.08
183 0.08
184 0.13
185 0.18
186 0.22
187 0.27
188 0.33
189 0.34
190 0.36
191 0.4
192 0.42
193 0.41
194 0.42
195 0.39
196 0.33
197 0.32
198 0.3
199 0.25
200 0.21
201 0.17
202 0.11
203 0.1
204 0.1
205 0.09
206 0.08
207 0.08
208 0.05
209 0.06
210 0.07
211 0.11
212 0.14
213 0.17
214 0.25
215 0.3
216 0.3
217 0.36
218 0.42
219 0.39
220 0.39
221 0.39
222 0.35
223 0.3
224 0.33
225 0.29
226 0.24
227 0.21
228 0.2
229 0.17
230 0.15
231 0.15
232 0.13
233 0.1
234 0.09
235 0.09
236 0.09
237 0.09
238 0.08
239 0.08
240 0.08
241 0.07
242 0.07
243 0.08
244 0.07
245 0.06
246 0.06
247 0.07
248 0.09
249 0.11
250 0.16
251 0.15
252 0.15
253 0.16
254 0.16
255 0.17
256 0.15
257 0.14
258 0.11
259 0.15
260 0.14
261 0.14
262 0.15
263 0.15
264 0.16
265 0.16
266 0.14
267 0.13
268 0.15
269 0.17
270 0.25
271 0.26
272 0.25
273 0.25
274 0.25
275 0.23
276 0.22
277 0.21
278 0.12
279 0.11
280 0.12
281 0.11
282 0.13
283 0.14
284 0.18