Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S9DKF1

Protein Details
Accession A0A1S9DKF1    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
247-268KQVKELKDELSKKKDKKRRYFWBasic
NLS Segment(s)
PositionSequence
197-199KRR
253-265KDELSKKKDKKRR
Subcellular Location(s) nucl 22, mito 2, cyto 1, pero 1, cysk 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MSTDTPPDSPQSFTTALPPSSLMAVHKDRFEAEFGREKRSDRAHRAHVYEDTQWIEDDLEDRIQLIGSSLNRDMNRLNLLLQKDRSDARQISDWQAHIDHLERELKASNAERDALRIALEESQNRSTQEKDIARHHETLQKQLSEMQNEVQTLNKKAESQAAMLTKKDSLLQKHTKASNLKVQKEKTQLEEALEKAKRRAADAQKKARIAESERDEAQKTLEETRNKLVSSRYKRSIVEEQRKALEKQVKELKDELSKKKDKKRRYFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.29
4 0.27
5 0.26
6 0.22
7 0.21
8 0.21
9 0.17
10 0.18
11 0.24
12 0.26
13 0.26
14 0.26
15 0.27
16 0.27
17 0.29
18 0.25
19 0.23
20 0.31
21 0.31
22 0.38
23 0.39
24 0.39
25 0.43
26 0.51
27 0.55
28 0.54
29 0.61
30 0.63
31 0.67
32 0.68
33 0.65
34 0.59
35 0.53
36 0.46
37 0.41
38 0.34
39 0.28
40 0.25
41 0.21
42 0.17
43 0.14
44 0.12
45 0.11
46 0.09
47 0.08
48 0.09
49 0.08
50 0.08
51 0.07
52 0.07
53 0.09
54 0.09
55 0.12
56 0.13
57 0.18
58 0.18
59 0.2
60 0.2
61 0.19
62 0.21
63 0.18
64 0.19
65 0.18
66 0.21
67 0.25
68 0.26
69 0.25
70 0.25
71 0.26
72 0.26
73 0.28
74 0.26
75 0.24
76 0.28
77 0.28
78 0.31
79 0.33
80 0.31
81 0.25
82 0.25
83 0.22
84 0.18
85 0.17
86 0.13
87 0.12
88 0.15
89 0.13
90 0.14
91 0.15
92 0.14
93 0.15
94 0.17
95 0.16
96 0.15
97 0.16
98 0.15
99 0.15
100 0.16
101 0.13
102 0.11
103 0.09
104 0.09
105 0.1
106 0.11
107 0.12
108 0.14
109 0.16
110 0.17
111 0.18
112 0.19
113 0.17
114 0.17
115 0.23
116 0.23
117 0.24
118 0.29
119 0.34
120 0.35
121 0.36
122 0.36
123 0.35
124 0.32
125 0.35
126 0.33
127 0.27
128 0.24
129 0.27
130 0.28
131 0.24
132 0.24
133 0.19
134 0.17
135 0.18
136 0.18
137 0.16
138 0.16
139 0.16
140 0.17
141 0.16
142 0.15
143 0.15
144 0.2
145 0.18
146 0.16
147 0.19
148 0.22
149 0.22
150 0.22
151 0.22
152 0.18
153 0.17
154 0.2
155 0.19
156 0.19
157 0.27
158 0.34
159 0.38
160 0.44
161 0.45
162 0.48
163 0.48
164 0.48
165 0.48
166 0.49
167 0.51
168 0.52
169 0.53
170 0.54
171 0.58
172 0.56
173 0.52
174 0.49
175 0.44
176 0.39
177 0.39
178 0.33
179 0.34
180 0.34
181 0.31
182 0.27
183 0.29
184 0.26
185 0.26
186 0.35
187 0.38
188 0.46
189 0.54
190 0.63
191 0.67
192 0.68
193 0.65
194 0.59
195 0.53
196 0.47
197 0.45
198 0.41
199 0.39
200 0.39
201 0.41
202 0.4
203 0.35
204 0.32
205 0.26
206 0.23
207 0.26
208 0.31
209 0.32
210 0.34
211 0.41
212 0.43
213 0.4
214 0.4
215 0.4
216 0.44
217 0.5
218 0.55
219 0.54
220 0.56
221 0.57
222 0.62
223 0.65
224 0.65
225 0.67
226 0.65
227 0.63
228 0.64
229 0.67
230 0.61
231 0.59
232 0.56
233 0.47
234 0.49
235 0.54
236 0.5
237 0.5
238 0.52
239 0.49
240 0.51
241 0.57
242 0.57
243 0.58
244 0.65
245 0.71
246 0.79
247 0.83
248 0.84