Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S9DGF5

Protein Details
Accession A0A1S9DGF5   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
86-105RYRQRERRWRAERKWMCRKVBasic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 4
Family & Domain DBs
Amino Acid Sequences MSAEPYFTPGSCAMRLQNVEGLSSVSKSALLRSIADDISAVFICISKQLSCGTLNARHTRPIHDFITSIRCTERLEQQRLQQDLERYRQRERRWRAERKWMCRKVEGLVKHSEVIHNQWKERLNKAKSNFEGATRELAALRWRYELSRSQAVKEKLLGRGDATLAETNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.27
4 0.28
5 0.24
6 0.24
7 0.22
8 0.22
9 0.16
10 0.15
11 0.13
12 0.09
13 0.11
14 0.1
15 0.12
16 0.14
17 0.15
18 0.15
19 0.17
20 0.2
21 0.18
22 0.17
23 0.16
24 0.12
25 0.13
26 0.12
27 0.09
28 0.06
29 0.07
30 0.07
31 0.08
32 0.1
33 0.08
34 0.09
35 0.1
36 0.12
37 0.12
38 0.14
39 0.17
40 0.21
41 0.26
42 0.3
43 0.31
44 0.35
45 0.35
46 0.39
47 0.39
48 0.38
49 0.34
50 0.29
51 0.28
52 0.24
53 0.31
54 0.26
55 0.22
56 0.17
57 0.17
58 0.18
59 0.2
60 0.27
61 0.27
62 0.33
63 0.35
64 0.39
65 0.45
66 0.45
67 0.44
68 0.37
69 0.34
70 0.33
71 0.38
72 0.38
73 0.34
74 0.39
75 0.44
76 0.48
77 0.53
78 0.56
79 0.6
80 0.65
81 0.73
82 0.71
83 0.77
84 0.79
85 0.79
86 0.83
87 0.79
88 0.73
89 0.65
90 0.61
91 0.54
92 0.53
93 0.46
94 0.39
95 0.36
96 0.34
97 0.32
98 0.31
99 0.28
100 0.22
101 0.24
102 0.29
103 0.27
104 0.27
105 0.3
106 0.36
107 0.38
108 0.45
109 0.49
110 0.47
111 0.52
112 0.57
113 0.62
114 0.57
115 0.61
116 0.54
117 0.47
118 0.44
119 0.38
120 0.36
121 0.27
122 0.26
123 0.19
124 0.19
125 0.21
126 0.21
127 0.21
128 0.19
129 0.2
130 0.21
131 0.25
132 0.3
133 0.32
134 0.39
135 0.39
136 0.41
137 0.48
138 0.5
139 0.49
140 0.47
141 0.45
142 0.41
143 0.43
144 0.4
145 0.33
146 0.32
147 0.3
148 0.25
149 0.24