Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8P320

Protein Details
Accession B8P320    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
82-124PLDLRPKKTRAIRRRLTPHEKSLKTLKQRKKDIHFPLRKYAVKBasic
NLS Segment(s)
PositionSequence
85-117LRPKKTRAIRRRLTPHEKSLKTLKQRKKDIHFP
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG ppl:POSPLDRAFT_126854  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPSNKVKAYELQSKSKNDLSKQLTELKNELLTLRVQKIAGGSAAKLTKINTVRKSIARVLTVMNQKQRQNLREFYKNKKYLPLDLRPKKTRAIRRRLTPHEKSLKTLKQRKKDIHFPLRKYAVKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.56
4 0.49
5 0.53
6 0.5
7 0.49
8 0.48
9 0.52
10 0.49
11 0.47
12 0.46
13 0.39
14 0.34
15 0.29
16 0.26
17 0.18
18 0.18
19 0.18
20 0.18
21 0.17
22 0.16
23 0.16
24 0.16
25 0.16
26 0.15
27 0.12
28 0.1
29 0.12
30 0.13
31 0.12
32 0.13
33 0.12
34 0.17
35 0.22
36 0.29
37 0.29
38 0.33
39 0.36
40 0.37
41 0.41
42 0.39
43 0.36
44 0.29
45 0.27
46 0.23
47 0.26
48 0.3
49 0.28
50 0.3
51 0.31
52 0.32
53 0.37
54 0.41
55 0.39
56 0.39
57 0.43
58 0.43
59 0.48
60 0.52
61 0.55
62 0.6
63 0.61
64 0.57
65 0.58
66 0.55
67 0.54
68 0.56
69 0.57
70 0.58
71 0.62
72 0.69
73 0.66
74 0.66
75 0.65
76 0.67
77 0.68
78 0.67
79 0.69
80 0.68
81 0.74
82 0.82
83 0.84
84 0.85
85 0.81
86 0.81
87 0.81
88 0.74
89 0.68
90 0.68
91 0.66
92 0.67
93 0.71
94 0.7
95 0.7
96 0.79
97 0.83
98 0.83
99 0.84
100 0.85
101 0.86
102 0.86
103 0.81
104 0.81
105 0.81
106 0.76