Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8P2L1

Protein Details
Accession B8P2L1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
145-166YGVRWIKQRNARRRERNEAPVEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, mito 5, E.R. 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ppl:POSPLDRAFT_103798  -  
Amino Acid Sequences MFEGAQRALGLSCRKPNVTIITQVAPPSVFAALFAQLAYNQRRNDGFCDEPRDHHQYHHHQPTRQMESSQLLFGFMQWEGGQLDITAQIAIAICGCLAIYTGWTAMHVKYMSCLCGAAISWIWMRSAIAAACILAAFVIAVVRQYGVRWIKQRNARRRERNEAPVEESSVESVYKRQTTRATAHLGLSHRKAGSRGDVSESFARRMPAEQGVYKIDSGQGFVDTQLAKCAIDRQVKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.42
4 0.44
5 0.42
6 0.42
7 0.39
8 0.38
9 0.38
10 0.37
11 0.33
12 0.25
13 0.22
14 0.17
15 0.13
16 0.1
17 0.09
18 0.1
19 0.1
20 0.1
21 0.09
22 0.08
23 0.09
24 0.15
25 0.2
26 0.25
27 0.24
28 0.28
29 0.3
30 0.32
31 0.35
32 0.36
33 0.35
34 0.34
35 0.42
36 0.4
37 0.41
38 0.45
39 0.47
40 0.42
41 0.41
42 0.46
43 0.47
44 0.55
45 0.62
46 0.62
47 0.58
48 0.65
49 0.69
50 0.68
51 0.6
52 0.51
53 0.43
54 0.41
55 0.39
56 0.33
57 0.24
58 0.17
59 0.15
60 0.14
61 0.13
62 0.09
63 0.08
64 0.07
65 0.08
66 0.07
67 0.07
68 0.07
69 0.06
70 0.06
71 0.05
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.03
80 0.03
81 0.03
82 0.03
83 0.02
84 0.03
85 0.03
86 0.03
87 0.04
88 0.04
89 0.04
90 0.05
91 0.06
92 0.06
93 0.09
94 0.09
95 0.08
96 0.1
97 0.11
98 0.1
99 0.09
100 0.09
101 0.06
102 0.07
103 0.07
104 0.06
105 0.05
106 0.06
107 0.06
108 0.07
109 0.07
110 0.06
111 0.06
112 0.06
113 0.07
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.04
120 0.04
121 0.03
122 0.03
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.03
129 0.03
130 0.03
131 0.04
132 0.1
133 0.13
134 0.17
135 0.22
136 0.26
137 0.33
138 0.42
139 0.52
140 0.56
141 0.63
142 0.7
143 0.76
144 0.8
145 0.82
146 0.81
147 0.81
148 0.77
149 0.71
150 0.65
151 0.56
152 0.49
153 0.41
154 0.33
155 0.24
156 0.18
157 0.15
158 0.1
159 0.11
160 0.14
161 0.18
162 0.18
163 0.22
164 0.26
165 0.31
166 0.35
167 0.37
168 0.39
169 0.36
170 0.37
171 0.37
172 0.36
173 0.36
174 0.34
175 0.34
176 0.28
177 0.28
178 0.28
179 0.27
180 0.31
181 0.3
182 0.29
183 0.31
184 0.31
185 0.34
186 0.39
187 0.38
188 0.33
189 0.3
190 0.3
191 0.25
192 0.26
193 0.25
194 0.25
195 0.28
196 0.28
197 0.29
198 0.31
199 0.32
200 0.3
201 0.27
202 0.24
203 0.19
204 0.19
205 0.16
206 0.14
207 0.13
208 0.13
209 0.17
210 0.15
211 0.15
212 0.17
213 0.17
214 0.15
215 0.16
216 0.21
217 0.25