Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S9E0F3

Protein Details
Accession A0A1S9E0F3    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRQPRKLKWTKTSRAANGKEHydrophilic
115-140GKQNKIHSEERPRQKKKTRVLVDGTTHydrophilic
NLS Segment(s)
PositionSequence
62-88RQRRERAFTKRRLAGKLARDRKREEDR
129-129K
Subcellular Location(s) nucl 13.5mito_nucl 13.5, mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000988  Ribosomal_L24e-rel  
Amino Acid Sequences MKRQPRKLKWTKTSRAANGKEMIVDSSLVLSQFAKKRNAPVKYDRNLVAATVKAMERVEEIRQRRERAFTKRRLAGKLARDRKREEDRRVVAEGEHLIRKELRDREEGMPLVQEGKQNKIHSEERPRQKKKTRVLVDGTTQEEIDVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.79
4 0.75
5 0.68
6 0.59
7 0.5
8 0.41
9 0.33
10 0.23
11 0.19
12 0.13
13 0.1
14 0.1
15 0.08
16 0.08
17 0.08
18 0.13
19 0.18
20 0.23
21 0.27
22 0.28
23 0.37
24 0.45
25 0.5
26 0.51
27 0.56
28 0.61
29 0.6
30 0.63
31 0.55
32 0.49
33 0.43
34 0.38
35 0.29
36 0.2
37 0.16
38 0.12
39 0.11
40 0.1
41 0.1
42 0.09
43 0.09
44 0.11
45 0.14
46 0.19
47 0.22
48 0.3
49 0.35
50 0.37
51 0.38
52 0.43
53 0.45
54 0.49
55 0.56
56 0.55
57 0.58
58 0.61
59 0.64
60 0.6
61 0.57
62 0.53
63 0.53
64 0.54
65 0.57
66 0.58
67 0.57
68 0.58
69 0.63
70 0.67
71 0.66
72 0.63
73 0.63
74 0.6
75 0.6
76 0.58
77 0.5
78 0.39
79 0.33
80 0.28
81 0.2
82 0.19
83 0.15
84 0.15
85 0.15
86 0.16
87 0.21
88 0.24
89 0.25
90 0.27
91 0.31
92 0.33
93 0.37
94 0.37
95 0.3
96 0.26
97 0.22
98 0.21
99 0.18
100 0.19
101 0.16
102 0.21
103 0.26
104 0.27
105 0.29
106 0.33
107 0.36
108 0.4
109 0.5
110 0.54
111 0.59
112 0.69
113 0.74
114 0.78
115 0.84
116 0.85
117 0.84
118 0.86
119 0.83
120 0.8
121 0.8
122 0.76
123 0.73
124 0.69
125 0.62
126 0.52
127 0.44