Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8P7C5

Protein Details
Accession B8P7C5   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
94-120LTKYGLPRLRYRRPPKNLRRIRVSRLWHydrophilic
NLS Segment(s)
PositionSequence
84-115RPGMGRRKPALTKYGLPRLRYRRPPKNLRRIR
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
KEGG ppl:POSPLDRAFT_91230  -  
Amino Acid Sequences MSLAAHDQYAGVRHINTWGCRRLRPSTIGQATRDKMAYGAAQRWPHDSSRRQEPPRNAPTNVRPVGQAQNRNASIAHVPGVHARPGMGRRKPALTKYGLPRLRYRRPPKNLRRIRVSRLWEARNPASNDDAASEVGRIPWHAGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.27
4 0.31
5 0.38
6 0.4
7 0.43
8 0.48
9 0.49
10 0.49
11 0.49
12 0.49
13 0.52
14 0.57
15 0.57
16 0.55
17 0.56
18 0.52
19 0.49
20 0.43
21 0.32
22 0.24
23 0.22
24 0.21
25 0.17
26 0.19
27 0.22
28 0.24
29 0.25
30 0.28
31 0.29
32 0.3
33 0.34
34 0.37
35 0.37
36 0.44
37 0.53
38 0.56
39 0.61
40 0.64
41 0.67
42 0.7
43 0.7
44 0.61
45 0.57
46 0.56
47 0.58
48 0.52
49 0.42
50 0.33
51 0.31
52 0.37
53 0.37
54 0.37
55 0.3
56 0.35
57 0.34
58 0.34
59 0.31
60 0.24
61 0.2
62 0.15
63 0.14
64 0.08
65 0.08
66 0.1
67 0.12
68 0.11
69 0.1
70 0.1
71 0.12
72 0.18
73 0.25
74 0.25
75 0.28
76 0.3
77 0.36
78 0.39
79 0.4
80 0.4
81 0.36
82 0.4
83 0.43
84 0.5
85 0.49
86 0.48
87 0.53
88 0.57
89 0.62
90 0.66
91 0.69
92 0.7
93 0.76
94 0.85
95 0.87
96 0.89
97 0.9
98 0.87
99 0.87
100 0.84
101 0.81
102 0.79
103 0.74
104 0.73
105 0.71
106 0.69
107 0.63
108 0.63
109 0.61
110 0.6
111 0.57
112 0.5
113 0.44
114 0.39
115 0.35
116 0.29
117 0.25
118 0.18
119 0.15
120 0.13
121 0.11
122 0.12
123 0.12
124 0.11