Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S9DG45

Protein Details
Accession A0A1S9DG45   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
32-57VPGQGKKATKLRVKRHFRRFWFCYLVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, cyto 6, cyto_nucl 5.5, extr 5, nucl 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022185  DUF3712  
IPR046368  Tag1  
Gene Ontology GO:0000329  C:fungal-type vacuole membrane  
Pfam View protein in Pfam  
PF12505  DUF3712  
Amino Acid Sequences MEKKYSEKDTRATKLSALDAEIEYVENAGSDVPGQGKKATKLRVKRHFRRFWFCYLVAGIVFLAIFLPIFFIYIIPAIAQRVVDDTSLPVYAARILDPTPDSVTFSIDTSLKIPAGLSVRIDPFSLSLFNREVKPMVPFIDVALQGYNLKGTTKMSISSNNTAVLNREQFVEALTKAVYSKQFKLSAKGSTTGHLGALKAPVTLDKDVELAGLDKLSGFSIDTASLILPAEEDGTNLRGTATLPNHSVVTFALGNVTLNLKSADVVIGQGYLDNVVLSPGNNTMPLRAILNIRTVLENLLDILGAQASALMDGKLEISASGNSTVYNGQHIPYFEEVLNNLTITARVPIATILSGTLSGLRNSSLLDGLNGTLDSAGGLLGNIAKLSDILGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.41
4 0.33
5 0.29
6 0.24
7 0.23
8 0.21
9 0.17
10 0.13
11 0.11
12 0.1
13 0.06
14 0.06
15 0.05
16 0.05
17 0.05
18 0.07
19 0.1
20 0.12
21 0.14
22 0.18
23 0.23
24 0.29
25 0.36
26 0.44
27 0.49
28 0.58
29 0.67
30 0.73
31 0.8
32 0.84
33 0.88
34 0.89
35 0.89
36 0.89
37 0.84
38 0.81
39 0.78
40 0.68
41 0.6
42 0.51
43 0.43
44 0.32
45 0.28
46 0.19
47 0.11
48 0.11
49 0.07
50 0.05
51 0.04
52 0.04
53 0.03
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.07
62 0.06
63 0.07
64 0.07
65 0.08
66 0.08
67 0.07
68 0.09
69 0.1
70 0.09
71 0.09
72 0.1
73 0.1
74 0.1
75 0.1
76 0.08
77 0.08
78 0.1
79 0.1
80 0.09
81 0.09
82 0.09
83 0.12
84 0.13
85 0.14
86 0.14
87 0.14
88 0.16
89 0.15
90 0.17
91 0.15
92 0.14
93 0.15
94 0.13
95 0.13
96 0.12
97 0.13
98 0.11
99 0.1
100 0.1
101 0.11
102 0.13
103 0.13
104 0.13
105 0.15
106 0.16
107 0.17
108 0.17
109 0.14
110 0.12
111 0.12
112 0.14
113 0.11
114 0.13
115 0.14
116 0.16
117 0.17
118 0.18
119 0.17
120 0.16
121 0.17
122 0.16
123 0.16
124 0.15
125 0.14
126 0.13
127 0.16
128 0.15
129 0.14
130 0.12
131 0.11
132 0.1
133 0.1
134 0.1
135 0.06
136 0.06
137 0.06
138 0.07
139 0.09
140 0.09
141 0.11
142 0.12
143 0.18
144 0.22
145 0.25
146 0.25
147 0.24
148 0.24
149 0.22
150 0.23
151 0.2
152 0.17
153 0.15
154 0.14
155 0.13
156 0.13
157 0.13
158 0.13
159 0.09
160 0.09
161 0.08
162 0.07
163 0.07
164 0.1
165 0.14
166 0.16
167 0.18
168 0.22
169 0.29
170 0.29
171 0.34
172 0.34
173 0.33
174 0.32
175 0.32
176 0.28
177 0.22
178 0.23
179 0.19
180 0.17
181 0.13
182 0.12
183 0.09
184 0.1
185 0.09
186 0.08
187 0.07
188 0.08
189 0.1
190 0.1
191 0.09
192 0.09
193 0.09
194 0.09
195 0.09
196 0.07
197 0.06
198 0.05
199 0.05
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.05
214 0.04
215 0.04
216 0.04
217 0.05
218 0.05
219 0.05
220 0.06
221 0.07
222 0.07
223 0.07
224 0.07
225 0.06
226 0.07
227 0.12
228 0.13
229 0.15
230 0.16
231 0.17
232 0.17
233 0.17
234 0.16
235 0.11
236 0.12
237 0.1
238 0.08
239 0.08
240 0.08
241 0.08
242 0.08
243 0.09
244 0.06
245 0.07
246 0.07
247 0.07
248 0.07
249 0.07
250 0.07
251 0.06
252 0.06
253 0.06
254 0.05
255 0.05
256 0.05
257 0.05
258 0.05
259 0.04
260 0.04
261 0.04
262 0.04
263 0.05
264 0.05
265 0.06
266 0.07
267 0.07
268 0.09
269 0.09
270 0.1
271 0.11
272 0.12
273 0.12
274 0.12
275 0.14
276 0.14
277 0.17
278 0.18
279 0.17
280 0.17
281 0.17
282 0.15
283 0.14
284 0.12
285 0.09
286 0.08
287 0.06
288 0.05
289 0.05
290 0.04
291 0.04
292 0.03
293 0.04
294 0.03
295 0.04
296 0.05
297 0.04
298 0.04
299 0.05
300 0.05
301 0.05
302 0.05
303 0.05
304 0.06
305 0.07
306 0.09
307 0.1
308 0.1
309 0.1
310 0.11
311 0.13
312 0.11
313 0.15
314 0.14
315 0.13
316 0.16
317 0.17
318 0.19
319 0.19
320 0.21
321 0.18
322 0.19
323 0.19
324 0.18
325 0.18
326 0.15
327 0.13
328 0.1
329 0.1
330 0.1
331 0.11
332 0.09
333 0.08
334 0.08
335 0.09
336 0.1
337 0.1
338 0.09
339 0.08
340 0.08
341 0.08
342 0.08
343 0.11
344 0.12
345 0.12
346 0.13
347 0.13
348 0.12
349 0.13
350 0.15
351 0.12
352 0.11
353 0.11
354 0.12
355 0.11
356 0.12
357 0.11
358 0.1
359 0.08
360 0.08
361 0.07
362 0.05
363 0.05
364 0.04
365 0.04
366 0.04
367 0.05
368 0.06
369 0.06
370 0.06
371 0.06
372 0.06