Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S9DPJ5

Protein Details
Accession A0A1S9DPJ5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
90-115PAKTASPAKKRCVKRKIRSEPEDDGVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MKSANPRAKPKTDEHLVFLYLCLINSGGVNTINFNAVADASNINVPAARMRWARLKARIEKEMAEGSGDPNAGEPSAASTPAASTPTPSPAKTASPAKKRCVKRKIRSEPEDDGVAENNDESNPTAEES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.52
3 0.46
4 0.4
5 0.34
6 0.28
7 0.19
8 0.17
9 0.13
10 0.1
11 0.09
12 0.09
13 0.09
14 0.07
15 0.08
16 0.08
17 0.08
18 0.09
19 0.09
20 0.09
21 0.08
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.07
31 0.07
32 0.06
33 0.07
34 0.08
35 0.11
36 0.12
37 0.14
38 0.21
39 0.26
40 0.3
41 0.36
42 0.42
43 0.47
44 0.51
45 0.52
46 0.46
47 0.42
48 0.4
49 0.33
50 0.26
51 0.19
52 0.14
53 0.11
54 0.1
55 0.09
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05
61 0.04
62 0.06
63 0.07
64 0.07
65 0.07
66 0.06
67 0.07
68 0.08
69 0.1
70 0.07
71 0.09
72 0.1
73 0.17
74 0.19
75 0.19
76 0.2
77 0.2
78 0.23
79 0.26
80 0.34
81 0.37
82 0.45
83 0.51
84 0.57
85 0.64
86 0.71
87 0.76
88 0.78
89 0.8
90 0.8
91 0.86
92 0.89
93 0.91
94 0.88
95 0.85
96 0.81
97 0.73
98 0.65
99 0.54
100 0.45
101 0.36
102 0.3
103 0.23
104 0.17
105 0.14
106 0.11
107 0.11
108 0.11
109 0.11