Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S9DWK5

Protein Details
Accession A0A1S9DWK5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
33-56CYSHKPKCARHWYPKKIGHRKSDYBasic
NLS Segment(s)
Subcellular Location(s) extr 15, golg 4, mito 2, cyto 2, E.R. 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MKLSTITLVAASILLSGAAATPFESAEVCRKACYSHKPKCARHWYPKKIGHRKSDYYEDDCGYDYEEFEWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.04
5 0.03
6 0.04
7 0.04
8 0.04
9 0.04
10 0.05
11 0.05
12 0.06
13 0.12
14 0.14
15 0.14
16 0.15
17 0.15
18 0.17
19 0.22
20 0.31
21 0.35
22 0.41
23 0.5
24 0.58
25 0.63
26 0.71
27 0.76
28 0.75
29 0.77
30 0.79
31 0.78
32 0.8
33 0.83
34 0.84
35 0.84
36 0.83
37 0.82
38 0.79
39 0.77
40 0.73
41 0.74
42 0.68
43 0.61
44 0.58
45 0.48
46 0.41
47 0.36
48 0.31
49 0.24
50 0.19
51 0.16