Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NZS2

Protein Details
Accession B8NZS2    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-40ELRVSVAHRRRCRRASKAKSKCWETEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8, cyto 2.5
Family & Domain DBs
KEGG ppl:POSPLDRAFT_100178  -  
Amino Acid Sequences MSRDLRARHRDDRAELRVSVAHRRRCRRASKAKSKCWETESKCRAGSRFWEKIHGCQQEHSEVYQLGDEEVECLCRDLGSSDRGESESWGCSTDLTEAMLVRAQHADASSGAVDSDVSISGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.55
3 0.49
4 0.44
5 0.4
6 0.43
7 0.42
8 0.45
9 0.5
10 0.59
11 0.65
12 0.71
13 0.78
14 0.78
15 0.81
16 0.83
17 0.85
18 0.87
19 0.88
20 0.88
21 0.84
22 0.78
23 0.72
24 0.71
25 0.66
26 0.67
27 0.62
28 0.58
29 0.55
30 0.52
31 0.48
32 0.4
33 0.42
34 0.39
35 0.41
36 0.37
37 0.43
38 0.42
39 0.46
40 0.52
41 0.5
42 0.42
43 0.36
44 0.38
45 0.33
46 0.33
47 0.27
48 0.2
49 0.14
50 0.14
51 0.12
52 0.1
53 0.07
54 0.06
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.09
66 0.11
67 0.12
68 0.12
69 0.13
70 0.14
71 0.14
72 0.14
73 0.13
74 0.13
75 0.12
76 0.13
77 0.12
78 0.11
79 0.12
80 0.12
81 0.11
82 0.09
83 0.1
84 0.08
85 0.09
86 0.12
87 0.11
88 0.1
89 0.11
90 0.1
91 0.1
92 0.11
93 0.11
94 0.09
95 0.11
96 0.1
97 0.1
98 0.09
99 0.08
100 0.08
101 0.07
102 0.08