Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XNQ6

Protein Details
Accession B7XNQ6    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
60-80NCSDKCKAVNCCKRNKTGKCQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 15, cyto 5.5
Family & Domain DBs
Amino Acid Sequences LREGSSEESEDCCCCDCNFQPSPLLQGTPIPMGSTIPLAGNFGGNGYSCVNIDCSPQTTNCSDKCKAVNCCKRNKTGKCQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.19
3 0.2
4 0.25
5 0.27
6 0.28
7 0.29
8 0.28
9 0.32
10 0.27
11 0.25
12 0.18
13 0.16
14 0.16
15 0.14
16 0.14
17 0.1
18 0.09
19 0.09
20 0.09
21 0.08
22 0.07
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.05
29 0.05
30 0.05
31 0.04
32 0.06
33 0.06
34 0.06
35 0.06
36 0.07
37 0.08
38 0.08
39 0.1
40 0.1
41 0.12
42 0.13
43 0.14
44 0.17
45 0.18
46 0.23
47 0.26
48 0.31
49 0.31
50 0.34
51 0.39
52 0.44
53 0.5
54 0.56
55 0.62
56 0.64
57 0.73
58 0.75
59 0.8
60 0.82