Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S9DZ34

Protein Details
Accession A0A1S9DZ34    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
34-55LAARIKRNRKTQQVKFKVRCQRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito_nucl 9.5, mito 7.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREISDIKQFIEICRRKDASCTFFTVVNRSVVLAARIKRNRKTQQVKFKVRCQRFVYTLALKDSDKADKLKQSLPPALKVVDVSKGEKKKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.43
3 0.44
4 0.4
5 0.47
6 0.51
7 0.46
8 0.43
9 0.45
10 0.38
11 0.39
12 0.4
13 0.37
14 0.31
15 0.26
16 0.23
17 0.18
18 0.17
19 0.14
20 0.15
21 0.16
22 0.16
23 0.24
24 0.3
25 0.35
26 0.41
27 0.5
28 0.56
29 0.62
30 0.7
31 0.7
32 0.75
33 0.8
34 0.84
35 0.79
36 0.81
37 0.8
38 0.73
39 0.72
40 0.66
41 0.6
42 0.52
43 0.51
44 0.47
45 0.41
46 0.4
47 0.34
48 0.31
49 0.26
50 0.25
51 0.23
52 0.22
53 0.2
54 0.21
55 0.23
56 0.27
57 0.3
58 0.34
59 0.37
60 0.4
61 0.45
62 0.45
63 0.45
64 0.42
65 0.39
66 0.35
67 0.31
68 0.26
69 0.26
70 0.26
71 0.27
72 0.33
73 0.38