Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XKE7

Protein Details
Accession B7XKE7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
81-100KKECSSQHTNAKKKINKKLNHydrophilic
NLS Segment(s)
PositionSequence
29-59KKMKKTKNSKDVVKEGSKISKNKIKSSDGKK
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
Amino Acid Sequences KDLANNDKIEEECNNVETHESNVSGESIKKMKKTKNSKDVVKEGSKISKNKIKSSDGKKSESAPKACIEELHEDETSLDGKKECSSQHTNAKKKINKKLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.19
4 0.17
5 0.18
6 0.15
7 0.14
8 0.13
9 0.13
10 0.13
11 0.13
12 0.13
13 0.14
14 0.17
15 0.2
16 0.25
17 0.31
18 0.37
19 0.46
20 0.57
21 0.63
22 0.68
23 0.73
24 0.75
25 0.75
26 0.75
27 0.71
28 0.63
29 0.54
30 0.46
31 0.46
32 0.44
33 0.38
34 0.37
35 0.36
36 0.36
37 0.39
38 0.42
39 0.4
40 0.44
41 0.5
42 0.55
43 0.54
44 0.55
45 0.51
46 0.51
47 0.54
48 0.53
49 0.47
50 0.39
51 0.36
52 0.35
53 0.34
54 0.3
55 0.24
56 0.23
57 0.24
58 0.25
59 0.23
60 0.2
61 0.21
62 0.2
63 0.19
64 0.13
65 0.12
66 0.09
67 0.1
68 0.12
69 0.15
70 0.16
71 0.22
72 0.28
73 0.34
74 0.44
75 0.53
76 0.6
77 0.66
78 0.75
79 0.75
80 0.78