Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B7XK25

Protein Details
Accession B7XK25    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-46YELYLLKKEKNIKKQKRQRKILFKNKKKGHNIIHydrophilic
NLS Segment(s)
PositionSequence
20-42KKEKNIKKQKRQRKILFKNKKKG
Subcellular Location(s) nucl 14, cyto 7.5, mito 5, cyto_pero 4.5
Family & Domain DBs
Amino Acid Sequences MDDFEIYDIDNENYELYLLKKEKNIKKQKRQRKILFKNKKKGHNIIVNSTDKYLLRIFMGYLYELKLHTDKTIMKFYALSIYKNNYKIKINTILKTNIIDKKKILEILKSYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.15
5 0.17
6 0.19
7 0.25
8 0.35
9 0.43
10 0.53
11 0.63
12 0.67
13 0.76
14 0.84
15 0.9
16 0.91
17 0.93
18 0.93
19 0.93
20 0.93
21 0.93
22 0.94
23 0.93
24 0.93
25 0.89
26 0.88
27 0.84
28 0.79
29 0.76
30 0.73
31 0.66
32 0.61
33 0.6
34 0.53
35 0.46
36 0.4
37 0.33
38 0.24
39 0.23
40 0.18
41 0.12
42 0.1
43 0.09
44 0.09
45 0.08
46 0.09
47 0.07
48 0.07
49 0.07
50 0.08
51 0.07
52 0.09
53 0.09
54 0.09
55 0.09
56 0.11
57 0.14
58 0.18
59 0.23
60 0.22
61 0.22
62 0.22
63 0.22
64 0.27
65 0.25
66 0.23
67 0.2
68 0.25
69 0.3
70 0.36
71 0.39
72 0.34
73 0.38
74 0.39
75 0.42
76 0.47
77 0.48
78 0.45
79 0.47
80 0.47
81 0.43
82 0.44
83 0.45
84 0.42
85 0.4
86 0.4
87 0.36
88 0.38
89 0.4
90 0.44
91 0.4
92 0.39