Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S9E166

Protein Details
Accession A0A1S9E166   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
12-40LLWKIPWRISQPQKARQRKRLRSVDNVVDHydrophilic
114-139AWEMRKRTAKLPKWTRVSQRVNPPGFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKATSPLFSGLLWKIPWRISQPQKARQRKRLRSVDNVVDTISAALARNGLKARSVDRWYREMPREEEMLPKDKYTLFDKKEKTYRKGIHSMLPLIARPLILQSLSTSNVTALAWEMRKRTAKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.23
4 0.28
5 0.29
6 0.38
7 0.43
8 0.52
9 0.59
10 0.66
11 0.75
12 0.81
13 0.85
14 0.86
15 0.88
16 0.88
17 0.89
18 0.9
19 0.86
20 0.84
21 0.82
22 0.8
23 0.72
24 0.62
25 0.52
26 0.41
27 0.34
28 0.25
29 0.17
30 0.09
31 0.05
32 0.05
33 0.07
34 0.07
35 0.09
36 0.1
37 0.1
38 0.12
39 0.13
40 0.15
41 0.2
42 0.24
43 0.26
44 0.29
45 0.33
46 0.34
47 0.39
48 0.41
49 0.39
50 0.37
51 0.35
52 0.33
53 0.3
54 0.31
55 0.27
56 0.28
57 0.24
58 0.22
59 0.2
60 0.19
61 0.21
62 0.22
63 0.28
64 0.26
65 0.33
66 0.36
67 0.42
68 0.49
69 0.54
70 0.53
71 0.55
72 0.58
73 0.56
74 0.61
75 0.56
76 0.54
77 0.5
78 0.47
79 0.39
80 0.34
81 0.28
82 0.21
83 0.2
84 0.14
85 0.1
86 0.1
87 0.08
88 0.07
89 0.08
90 0.08
91 0.1
92 0.12
93 0.13
94 0.12
95 0.11
96 0.12
97 0.11
98 0.1
99 0.09
100 0.11
101 0.14
102 0.16
103 0.18
104 0.24
105 0.3
106 0.32
107 0.4
108 0.46
109 0.53
110 0.61
111 0.7
112 0.73
113 0.75
114 0.81
115 0.82
116 0.82
117 0.82
118 0.79
119 0.8