Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XPQ3

Protein Details
Accession B7XPQ3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
61-89ARKGRMAHPTKTHRRWHKKTPLNTRRLVTBasic
NLS Segment(s)
PositionSequence
45-53KGSGTRRSG
59-79NFARKGRMAHPTKTHRRWHKK
Subcellular Location(s) mito 17.5, cyto_mito 12, cyto 5.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002136  Ribosomal_L4/L1e  
IPR023574  Ribosomal_L4_dom_sf  
IPR045240  Ribosomal_L4_euk/arch  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00573  Ribosomal_L4  
Amino Acid Sequences MVMKTFACVNQNSRQPYAVSPNAGMQHSAESWGTGRAIAKVPRVKGSGTRRSGQGAFANFARKGRMAHPTKTHRRWHKKTPLNTRRLVTAMGVAASGMQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.39
3 0.39
4 0.42
5 0.37
6 0.32
7 0.28
8 0.3
9 0.31
10 0.3
11 0.27
12 0.19
13 0.17
14 0.15
15 0.16
16 0.12
17 0.1
18 0.1
19 0.11
20 0.1
21 0.09
22 0.09
23 0.09
24 0.13
25 0.15
26 0.2
27 0.23
28 0.25
29 0.27
30 0.28
31 0.27
32 0.31
33 0.38
34 0.41
35 0.4
36 0.4
37 0.38
38 0.4
39 0.39
40 0.34
41 0.29
42 0.21
43 0.19
44 0.19
45 0.21
46 0.19
47 0.19
48 0.18
49 0.15
50 0.16
51 0.17
52 0.26
53 0.27
54 0.32
55 0.41
56 0.5
57 0.59
58 0.66
59 0.73
60 0.74
61 0.81
62 0.83
63 0.85
64 0.85
65 0.84
66 0.86
67 0.88
68 0.88
69 0.84
70 0.83
71 0.73
72 0.67
73 0.59
74 0.5
75 0.39
76 0.32
77 0.25
78 0.19
79 0.17
80 0.13