Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B7XLJ8

Protein Details
Accession B7XLJ8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPKGNKKPKDKNAPKKPCSSYMHydrophilic
NLS Segment(s)
PositionSequence
5-15NKKPKDKNAPK
Subcellular Location(s) nucl 14.5, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MPKGNKKPKDKNAPKKPCSSYMLFGHELRKNDATIKALRVTEQAKQIGERWNALTEAEKSEYEKKAMEAKEKYNQELEIFKPPMSSRSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.83
4 0.78
5 0.72
6 0.66
7 0.6
8 0.54
9 0.54
10 0.47
11 0.44
12 0.43
13 0.41
14 0.38
15 0.36
16 0.32
17 0.27
18 0.27
19 0.27
20 0.24
21 0.22
22 0.23
23 0.22
24 0.21
25 0.21
26 0.21
27 0.21
28 0.2
29 0.22
30 0.22
31 0.19
32 0.19
33 0.21
34 0.25
35 0.25
36 0.23
37 0.2
38 0.19
39 0.19
40 0.19
41 0.18
42 0.13
43 0.15
44 0.15
45 0.15
46 0.17
47 0.22
48 0.23
49 0.23
50 0.22
51 0.21
52 0.26
53 0.29
54 0.34
55 0.33
56 0.37
57 0.45
58 0.47
59 0.48
60 0.44
61 0.42
62 0.36
63 0.36
64 0.33
65 0.33
66 0.32
67 0.3
68 0.3
69 0.3