Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XHS0

Protein Details
Accession B7XHS0   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
34-59LVTCGTYLKKKNKSKKWSKADTEKFYHydrophilic
NLS Segment(s)
PositionSequence
43-49KKNKSKK
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR039467  TFIIIB_B''_Myb  
Pfam View protein in Pfam  
PF15963  Myb_DNA-bind_7  
Amino Acid Sequences MNKNIDNIKYFCDNKNFKFKKPQHIENVNEEFDLVTCGTYLKKKNKSKKWSKADTEKFYLALTICGCDFSLMEKIFTERSRKNIKDKFLNERKINSKLISDLLKQHHGFDKAKFDSLLDNNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.6
3 0.59
4 0.57
5 0.65
6 0.67
7 0.68
8 0.71
9 0.74
10 0.73
11 0.78
12 0.77
13 0.74
14 0.72
15 0.62
16 0.52
17 0.43
18 0.33
19 0.24
20 0.21
21 0.12
22 0.06
23 0.06
24 0.06
25 0.08
26 0.13
27 0.2
28 0.28
29 0.38
30 0.47
31 0.58
32 0.68
33 0.77
34 0.83
35 0.87
36 0.87
37 0.87
38 0.86
39 0.86
40 0.85
41 0.79
42 0.72
43 0.62
44 0.52
45 0.43
46 0.36
47 0.25
48 0.17
49 0.12
50 0.08
51 0.07
52 0.07
53 0.07
54 0.06
55 0.06
56 0.06
57 0.11
58 0.11
59 0.11
60 0.11
61 0.13
62 0.15
63 0.18
64 0.22
65 0.19
66 0.27
67 0.36
68 0.4
69 0.49
70 0.52
71 0.57
72 0.61
73 0.64
74 0.68
75 0.68
76 0.73
77 0.67
78 0.68
79 0.67
80 0.62
81 0.6
82 0.51
83 0.43
84 0.36
85 0.36
86 0.33
87 0.29
88 0.31
89 0.33
90 0.39
91 0.37
92 0.39
93 0.41
94 0.43
95 0.43
96 0.41
97 0.45
98 0.4
99 0.43
100 0.4
101 0.34
102 0.36