Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S9DHZ5

Protein Details
Accession A0A1S9DHZ5   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
165-184LRVFKLMKQAEKKNKQNGSAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 11.5, nucl 9.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR023389  DOPA-like_sf  
IPR014980  DOPA_dioxygen  
Gene Ontology GO:0051213  F:dioxygenase activity  
Pfam View protein in Pfam  
PF08883  DOPA_dioxygen  
Amino Acid Sequences MTDQFAFDYPSPLKGYEGLEPLPVELHEDGKTVKNPQHGILSKAYEEFPDPLAKDRRGGFDVHIYHFQNNPDQVAYARALYERVRREFPELRIYRFFEGPLGPHPIAMFEVNIFTPAQFGAFIPWLIINRGPLSALLHPNTDEEEEERNHTQRATWLGDKIPLDLRVFKLMKQAEKKNKQNGSAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.23
4 0.26
5 0.23
6 0.23
7 0.22
8 0.21
9 0.19
10 0.16
11 0.15
12 0.12
13 0.14
14 0.12
15 0.13
16 0.15
17 0.18
18 0.21
19 0.22
20 0.25
21 0.29
22 0.31
23 0.32
24 0.4
25 0.37
26 0.38
27 0.38
28 0.37
29 0.31
30 0.31
31 0.29
32 0.2
33 0.2
34 0.18
35 0.15
36 0.16
37 0.16
38 0.21
39 0.26
40 0.26
41 0.28
42 0.29
43 0.32
44 0.3
45 0.3
46 0.25
47 0.27
48 0.29
49 0.28
50 0.31
51 0.28
52 0.28
53 0.29
54 0.29
55 0.25
56 0.23
57 0.21
58 0.16
59 0.15
60 0.14
61 0.14
62 0.13
63 0.09
64 0.09
65 0.08
66 0.1
67 0.11
68 0.17
69 0.2
70 0.22
71 0.24
72 0.25
73 0.31
74 0.34
75 0.35
76 0.4
77 0.36
78 0.37
79 0.38
80 0.39
81 0.34
82 0.3
83 0.27
84 0.17
85 0.16
86 0.14
87 0.13
88 0.17
89 0.15
90 0.15
91 0.15
92 0.14
93 0.14
94 0.13
95 0.11
96 0.05
97 0.06
98 0.06
99 0.07
100 0.07
101 0.05
102 0.06
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.07
109 0.07
110 0.07
111 0.08
112 0.08
113 0.09
114 0.1
115 0.1
116 0.1
117 0.1
118 0.1
119 0.09
120 0.12
121 0.15
122 0.18
123 0.18
124 0.18
125 0.18
126 0.19
127 0.2
128 0.18
129 0.15
130 0.13
131 0.16
132 0.16
133 0.21
134 0.23
135 0.23
136 0.23
137 0.23
138 0.22
139 0.22
140 0.26
141 0.27
142 0.27
143 0.28
144 0.28
145 0.33
146 0.32
147 0.31
148 0.3
149 0.27
150 0.27
151 0.28
152 0.29
153 0.33
154 0.33
155 0.32
156 0.36
157 0.38
158 0.45
159 0.5
160 0.58
161 0.6
162 0.7
163 0.78
164 0.8
165 0.82