Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S9DZL2

Protein Details
Accession A0A1S9DZL2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
20-39AKRGKGKTATKQKQNLKSPVHydrophilic
NLS Segment(s)
PositionSequence
16-28KSEAAKRGKGKTA
Subcellular Location(s) mito 7cyto 7plas 7cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAQTPQQRKANEKYAKSEAAKRGKGKTATKQKQNLKSPVSTGWVGMSRKSRIITVPEANEAPTVVLAFAVCGGLAFEALRIVPELWSAAVAMFNRKLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.61
4 0.61
5 0.6
6 0.61
7 0.63
8 0.6
9 0.59
10 0.59
11 0.63
12 0.61
13 0.63
14 0.65
15 0.67
16 0.71
17 0.75
18 0.77
19 0.79
20 0.81
21 0.78
22 0.71
23 0.63
24 0.56
25 0.49
26 0.44
27 0.34
28 0.26
29 0.19
30 0.2
31 0.19
32 0.19
33 0.21
34 0.19
35 0.21
36 0.21
37 0.2
38 0.17
39 0.21
40 0.23
41 0.23
42 0.23
43 0.23
44 0.23
45 0.22
46 0.2
47 0.16
48 0.12
49 0.08
50 0.06
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.04
66 0.05
67 0.06
68 0.06
69 0.06
70 0.07
71 0.08
72 0.07
73 0.08
74 0.08
75 0.07
76 0.09
77 0.1
78 0.15