Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XLT5

Protein Details
Accession B7XLT5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
9-32EIFQKKNKFLGKKKKFLRAPRGAPHydrophilic
NLS Segment(s)
PositionSequence
13-46KKNKFLGKKKKFLRAPRGAPPFLGEKKKKPGGEK
Subcellular Location(s) mito 20, cyto 4.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MFFFLKNFEIFQKKNKFLGKKKKFLRAPRGAPPFLGEKKKKPGGEKTPLFFTKPPPKNFFFFSPGGGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.62
4 0.65
5 0.74
6 0.74
7 0.75
8 0.78
9 0.81
10 0.81
11 0.82
12 0.82
13 0.81
14 0.77
15 0.76
16 0.76
17 0.66
18 0.58
19 0.5
20 0.45
21 0.39
22 0.42
23 0.35
24 0.33
25 0.41
26 0.48
27 0.49
28 0.49
29 0.54
30 0.55
31 0.63
32 0.63
33 0.58
34 0.6
35 0.58
36 0.56
37 0.47
38 0.47
39 0.48
40 0.51
41 0.55
42 0.53
43 0.56
44 0.56
45 0.59
46 0.56
47 0.5
48 0.43
49 0.4