Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S9DCN8

Protein Details
Accession A0A1S9DCN8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
68-93LTVCTLNYINRKRRNRPWPLSRSPLFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, E.R. 5, mito 3, golg 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002076  ELO_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0009922  F:fatty acid elongase activity  
GO:0102756  F:very-long-chain 3-ketoacyl-CoA synthase activity  
GO:0006633  P:fatty acid biosynthetic process  
Pfam View protein in Pfam  
PF01151  ELO  
Amino Acid Sequences MAGPMLPMYFGLPDAHLFELPPDSHPLPSSPASRSQLSWDRPINISPALFYHTLDVKLPLLIATLYALTVCTLNYINRKRRNRPWPLSRSPLFHQFVLIHNVGLVLFSAWLTLGTYQTIKSTLMDQRNNPPLASAIHVLCKFDRKDELSYFLQRRVSESRSHLDLNDHRSEVVHPGVLEFDSLWDRGIDYYMWMFYMSKFYEIVDTMLLLVKGKKSSFLQTYHHAGVMLCTWAGVRYVSPPGLIGLLLNSVIHTIMYLYYTLTTLKVSIPGFLKRILTGMQIAQFILGSILAWSYIFISYDASIWPPLASINNKREENRGNESRTSTFFHEDNSQLIPCLDNSGQVLALLLTTVYLIPLTFLFVRFFIRSYLSGSKRKLVKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.14
5 0.14
6 0.18
7 0.18
8 0.19
9 0.23
10 0.22
11 0.24
12 0.25
13 0.25
14 0.25
15 0.29
16 0.31
17 0.28
18 0.35
19 0.38
20 0.39
21 0.38
22 0.41
23 0.46
24 0.46
25 0.51
26 0.47
27 0.47
28 0.47
29 0.47
30 0.42
31 0.36
32 0.31
33 0.24
34 0.2
35 0.21
36 0.19
37 0.18
38 0.18
39 0.19
40 0.2
41 0.2
42 0.2
43 0.17
44 0.17
45 0.16
46 0.12
47 0.1
48 0.09
49 0.08
50 0.07
51 0.06
52 0.06
53 0.05
54 0.06
55 0.05
56 0.06
57 0.05
58 0.06
59 0.08
60 0.12
61 0.21
62 0.3
63 0.4
64 0.5
65 0.59
66 0.67
67 0.76
68 0.83
69 0.85
70 0.86
71 0.87
72 0.87
73 0.86
74 0.86
75 0.79
76 0.74
77 0.67
78 0.67
79 0.58
80 0.48
81 0.42
82 0.35
83 0.34
84 0.34
85 0.3
86 0.2
87 0.17
88 0.17
89 0.14
90 0.13
91 0.1
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.05
100 0.05
101 0.06
102 0.07
103 0.08
104 0.08
105 0.1
106 0.09
107 0.09
108 0.14
109 0.2
110 0.27
111 0.31
112 0.33
113 0.4
114 0.47
115 0.47
116 0.42
117 0.35
118 0.29
119 0.26
120 0.25
121 0.2
122 0.13
123 0.17
124 0.18
125 0.18
126 0.18
127 0.23
128 0.21
129 0.21
130 0.25
131 0.23
132 0.28
133 0.28
134 0.33
135 0.31
136 0.37
137 0.37
138 0.36
139 0.36
140 0.31
141 0.34
142 0.33
143 0.32
144 0.29
145 0.31
146 0.31
147 0.31
148 0.31
149 0.28
150 0.29
151 0.3
152 0.32
153 0.31
154 0.27
155 0.24
156 0.24
157 0.24
158 0.21
159 0.17
160 0.12
161 0.09
162 0.09
163 0.09
164 0.09
165 0.08
166 0.05
167 0.06
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.07
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.06
182 0.05
183 0.09
184 0.09
185 0.09
186 0.1
187 0.1
188 0.11
189 0.11
190 0.11
191 0.07
192 0.07
193 0.06
194 0.07
195 0.07
196 0.06
197 0.06
198 0.07
199 0.09
200 0.09
201 0.11
202 0.12
203 0.17
204 0.21
205 0.24
206 0.26
207 0.29
208 0.34
209 0.32
210 0.3
211 0.26
212 0.21
213 0.18
214 0.16
215 0.12
216 0.07
217 0.06
218 0.05
219 0.05
220 0.06
221 0.05
222 0.05
223 0.07
224 0.09
225 0.09
226 0.09
227 0.09
228 0.09
229 0.09
230 0.09
231 0.06
232 0.05
233 0.05
234 0.05
235 0.05
236 0.04
237 0.04
238 0.04
239 0.04
240 0.04
241 0.04
242 0.04
243 0.04
244 0.05
245 0.05
246 0.05
247 0.06
248 0.06
249 0.07
250 0.07
251 0.07
252 0.07
253 0.12
254 0.11
255 0.14
256 0.17
257 0.19
258 0.2
259 0.22
260 0.22
261 0.18
262 0.19
263 0.17
264 0.15
265 0.14
266 0.15
267 0.15
268 0.15
269 0.14
270 0.13
271 0.12
272 0.1
273 0.09
274 0.06
275 0.04
276 0.04
277 0.04
278 0.04
279 0.04
280 0.04
281 0.05
282 0.05
283 0.06
284 0.06
285 0.07
286 0.08
287 0.09
288 0.09
289 0.09
290 0.09
291 0.09
292 0.09
293 0.07
294 0.08
295 0.12
296 0.18
297 0.25
298 0.32
299 0.4
300 0.44
301 0.45
302 0.51
303 0.53
304 0.54
305 0.55
306 0.55
307 0.52
308 0.53
309 0.56
310 0.52
311 0.48
312 0.45
313 0.4
314 0.36
315 0.32
316 0.31
317 0.32
318 0.3
319 0.29
320 0.28
321 0.24
322 0.21
323 0.21
324 0.19
325 0.14
326 0.18
327 0.16
328 0.14
329 0.15
330 0.16
331 0.15
332 0.14
333 0.14
334 0.09
335 0.09
336 0.07
337 0.05
338 0.04
339 0.04
340 0.04
341 0.04
342 0.04
343 0.04
344 0.05
345 0.05
346 0.09
347 0.1
348 0.11
349 0.13
350 0.13
351 0.18
352 0.18
353 0.19
354 0.18
355 0.2
356 0.2
357 0.25
358 0.34
359 0.37
360 0.44
361 0.47
362 0.53