Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S9DM32

Protein Details
Accession A0A1S9DM32    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-99LLAGGKKDKKKENGNKGMLFHydrophilic
NLS Segment(s)
PositionSequence
85-90KKDKKK
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MVQGSLKKKAGTGPKRYATVLLYKSFLSQPRALGPKPGPRQIAPKKQSLIKQQKMTKKLTAGLISKTERNLAQKAGHLELLAGGKKDKKKENGNKGMLFLDLRWACQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.61
3 0.61
4 0.56
5 0.48
6 0.46
7 0.41
8 0.33
9 0.29
10 0.27
11 0.28
12 0.29
13 0.3
14 0.27
15 0.25
16 0.24
17 0.29
18 0.33
19 0.32
20 0.34
21 0.35
22 0.39
23 0.43
24 0.46
25 0.43
26 0.4
27 0.51
28 0.54
29 0.6
30 0.53
31 0.54
32 0.51
33 0.53
34 0.57
35 0.57
36 0.58
37 0.54
38 0.59
39 0.6
40 0.64
41 0.65
42 0.63
43 0.55
44 0.46
45 0.42
46 0.38
47 0.36
48 0.31
49 0.28
50 0.29
51 0.27
52 0.27
53 0.25
54 0.23
55 0.2
56 0.22
57 0.22
58 0.2
59 0.21
60 0.23
61 0.25
62 0.25
63 0.23
64 0.19
65 0.17
66 0.16
67 0.17
68 0.15
69 0.13
70 0.13
71 0.18
72 0.23
73 0.31
74 0.37
75 0.43
76 0.53
77 0.63
78 0.72
79 0.77
80 0.81
81 0.76
82 0.7
83 0.62
84 0.53
85 0.43
86 0.32
87 0.31
88 0.23