Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B7XMD3

Protein Details
Accession B7XMD3    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-30VAKFNKFPKPYQFKKKPLFFFCPHydrophilic
NLS Segment(s)
PositionSequence
57-83IERGGKKNPNWGRKNTFWAKIPKKKKG
Subcellular Location(s) mito 22.5, mito_nucl 13.333, nucl 3, cyto_nucl 2.833
Family & Domain DBs
Amino Acid Sequences MEKNPENVAKFNKFPKPYQFKKKPLFFFCPPGRCPFLGKLKPPWHWDWAPFSKTTKIERGGKKNPNWGRKNTFWAKIPKKKKGGGFIYPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.6
3 0.62
4 0.66
5 0.73
6 0.75
7 0.76
8 0.82
9 0.86
10 0.84
11 0.81
12 0.79
13 0.72
14 0.71
15 0.69
16 0.65
17 0.58
18 0.54
19 0.5
20 0.43
21 0.42
22 0.39
23 0.41
24 0.4
25 0.41
26 0.46
27 0.49
28 0.53
29 0.54
30 0.51
31 0.46
32 0.42
33 0.41
34 0.39
35 0.38
36 0.35
37 0.32
38 0.31
39 0.31
40 0.33
41 0.34
42 0.32
43 0.33
44 0.4
45 0.47
46 0.54
47 0.59
48 0.65
49 0.66
50 0.7
51 0.73
52 0.74
53 0.72
54 0.71
55 0.69
56 0.66
57 0.7
58 0.67
59 0.64
60 0.61
61 0.66
62 0.68
63 0.71
64 0.76
65 0.76
66 0.78
67 0.79
68 0.79
69 0.79
70 0.76