Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XLS0

Protein Details
Accession B7XLS0    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
24-43YSCIYRLKCKPEQRTCRALQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 7.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
Amino Acid Sequences MQAIEGRSFLNATIQCLVGLRAFYSCIYRLKCKPEQRTCRALQQLVRSYDECKNACDPKEFIEKIGLGDAPPHDAHKFLVELLTSLENEYEKVGEIFRVKCIQVIECKKCNEYIQMDDLWMVCPAIGMGAGDPSIEKGLLGLDTSHRIPMKCSKCHGNDVEVRRQVDGSGACIIFQVNHANKKGEESNDMVRVERRLHMHSGVYRLVGCGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.18
4 0.2
5 0.14
6 0.14
7 0.11
8 0.1
9 0.11
10 0.12
11 0.14
12 0.16
13 0.21
14 0.25
15 0.32
16 0.37
17 0.44
18 0.53
19 0.59
20 0.67
21 0.72
22 0.78
23 0.78
24 0.81
25 0.77
26 0.77
27 0.74
28 0.68
29 0.62
30 0.6
31 0.61
32 0.55
33 0.54
34 0.46
35 0.43
36 0.44
37 0.46
38 0.37
39 0.32
40 0.36
41 0.38
42 0.39
43 0.39
44 0.34
45 0.32
46 0.41
47 0.38
48 0.32
49 0.31
50 0.29
51 0.26
52 0.26
53 0.21
54 0.12
55 0.13
56 0.13
57 0.12
58 0.12
59 0.13
60 0.11
61 0.12
62 0.12
63 0.12
64 0.12
65 0.09
66 0.1
67 0.08
68 0.08
69 0.09
70 0.09
71 0.08
72 0.07
73 0.08
74 0.07
75 0.07
76 0.07
77 0.06
78 0.05
79 0.05
80 0.05
81 0.07
82 0.1
83 0.1
84 0.12
85 0.13
86 0.13
87 0.15
88 0.15
89 0.15
90 0.2
91 0.28
92 0.31
93 0.34
94 0.35
95 0.34
96 0.35
97 0.34
98 0.31
99 0.25
100 0.23
101 0.2
102 0.19
103 0.19
104 0.18
105 0.17
106 0.13
107 0.1
108 0.07
109 0.05
110 0.04
111 0.04
112 0.03
113 0.03
114 0.03
115 0.02
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.04
122 0.04
123 0.04
124 0.03
125 0.04
126 0.04
127 0.05
128 0.05
129 0.06
130 0.09
131 0.09
132 0.13
133 0.14
134 0.14
135 0.17
136 0.26
137 0.33
138 0.35
139 0.39
140 0.44
141 0.46
142 0.54
143 0.53
144 0.5
145 0.5
146 0.52
147 0.57
148 0.53
149 0.5
150 0.43
151 0.41
152 0.34
153 0.31
154 0.25
155 0.18
156 0.18
157 0.17
158 0.16
159 0.16
160 0.16
161 0.12
162 0.13
163 0.19
164 0.2
165 0.26
166 0.29
167 0.31
168 0.31
169 0.37
170 0.4
171 0.34
172 0.33
173 0.32
174 0.36
175 0.39
176 0.39
177 0.35
178 0.33
179 0.33
180 0.32
181 0.32
182 0.31
183 0.29
184 0.33
185 0.34
186 0.38
187 0.38
188 0.4
189 0.37
190 0.34
191 0.31