Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S9D4K2

Protein Details
Accession A0A1S9D4K2    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
8-27RLKWYEWKLNWPKQRNDPSAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010760  DNA-repair_Swi5  
Gene Ontology GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF07061  Swi5  
Amino Acid Sequences MPRSQFWRLKWYEWKLNWPKQRNDPSATVQRHIRLLHEYNKIKDIGQGLMGLIADARGVRQIEVQKEYGVGDRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.68
3 0.73
4 0.76
5 0.74
6 0.73
7 0.73
8 0.8
9 0.75
10 0.69
11 0.64
12 0.61
13 0.62
14 0.57
15 0.5
16 0.43
17 0.39
18 0.38
19 0.34
20 0.29
21 0.24
22 0.26
23 0.3
24 0.36
25 0.36
26 0.34
27 0.36
28 0.35
29 0.3
30 0.29
31 0.23
32 0.16
33 0.14
34 0.13
35 0.1
36 0.1
37 0.1
38 0.07
39 0.05
40 0.04
41 0.04
42 0.03
43 0.04
44 0.06
45 0.07
46 0.08
47 0.13
48 0.18
49 0.23
50 0.27
51 0.29
52 0.26
53 0.26
54 0.27