Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8W8A5

Protein Details
Accession A0A1S8W8A5    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
114-135GQSSPIPSKPRKSNKWVRFTVLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036570  HORMA_dom_sf  
Amino Acid Sequences MQHHRIPADRQHSSELSNSTISSSSPRATKADQLLLNFYSKTAQVIVQSRLAHILPGRHHSVNTFNAYSSNTHNDNGIASRDTTNGSASGQAATSTDPRNVPAAGNYSGPSSSGQSSPIPSKPRKSNKWVRFTVLTLFHVPSIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.37
3 0.3
4 0.28
5 0.25
6 0.21
7 0.19
8 0.18
9 0.17
10 0.17
11 0.17
12 0.18
13 0.2
14 0.22
15 0.24
16 0.3
17 0.3
18 0.35
19 0.34
20 0.34
21 0.35
22 0.32
23 0.32
24 0.26
25 0.21
26 0.15
27 0.13
28 0.12
29 0.1
30 0.1
31 0.13
32 0.17
33 0.19
34 0.22
35 0.22
36 0.21
37 0.22
38 0.21
39 0.18
40 0.15
41 0.17
42 0.14
43 0.18
44 0.22
45 0.21
46 0.21
47 0.21
48 0.24
49 0.24
50 0.26
51 0.22
52 0.18
53 0.18
54 0.19
55 0.19
56 0.17
57 0.18
58 0.15
59 0.15
60 0.15
61 0.14
62 0.14
63 0.14
64 0.12
65 0.09
66 0.09
67 0.09
68 0.1
69 0.11
70 0.11
71 0.1
72 0.09
73 0.09
74 0.09
75 0.08
76 0.08
77 0.07
78 0.07
79 0.06
80 0.07
81 0.1
82 0.11
83 0.13
84 0.13
85 0.14
86 0.15
87 0.16
88 0.15
89 0.14
90 0.17
91 0.16
92 0.17
93 0.16
94 0.16
95 0.15
96 0.15
97 0.14
98 0.12
99 0.13
100 0.13
101 0.15
102 0.15
103 0.18
104 0.22
105 0.27
106 0.33
107 0.36
108 0.44
109 0.52
110 0.62
111 0.67
112 0.73
113 0.78
114 0.8
115 0.85
116 0.81
117 0.77
118 0.71
119 0.65
120 0.61
121 0.55
122 0.49
123 0.42
124 0.39