Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B7XJ95

Protein Details
Accession B7XJ95    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
154-175IFIPHKKHKEFIKINKKKSFSSHydrophilic
NLS Segment(s)
PositionSequence
166-170KINKK
Subcellular Location(s) nucl 18.5, mito_nucl 11.5, mito 3.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR023398  TIF_eIF4e-like  
IPR001040  TIF_eIF_4E  
Gene Ontology GO:0003723  F:RNA binding  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF01652  IF4E  
Amino Acid Sequences MDSFYTNQWELLQHLNIDKSGIRDWGESFEVMGKIDNVEKLNYMISKIKEKKLDNLNDLYFFKQGIKPMWEDSCNVNGGRLIAEFSINHPRMIEYLARTFMWAFLNSYPSIVGVAFNEKEKTNRICLWIGDCSESDDICKAWKVILGLSLQSIIFIPHKKHKEFIKINKKKSFSSNQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.22
4 0.22
5 0.21
6 0.18
7 0.18
8 0.19
9 0.18
10 0.18
11 0.19
12 0.22
13 0.22
14 0.19
15 0.18
16 0.18
17 0.17
18 0.16
19 0.15
20 0.11
21 0.11
22 0.12
23 0.15
24 0.13
25 0.13
26 0.13
27 0.13
28 0.15
29 0.15
30 0.16
31 0.18
32 0.19
33 0.28
34 0.33
35 0.38
36 0.43
37 0.45
38 0.5
39 0.55
40 0.59
41 0.53
42 0.53
43 0.49
44 0.45
45 0.44
46 0.37
47 0.28
48 0.22
49 0.2
50 0.16
51 0.18
52 0.17
53 0.18
54 0.18
55 0.21
56 0.23
57 0.22
58 0.21
59 0.21
60 0.2
61 0.2
62 0.18
63 0.15
64 0.13
65 0.12
66 0.11
67 0.09
68 0.07
69 0.06
70 0.06
71 0.06
72 0.08
73 0.17
74 0.17
75 0.17
76 0.17
77 0.17
78 0.16
79 0.18
80 0.17
81 0.1
82 0.11
83 0.13
84 0.13
85 0.13
86 0.13
87 0.13
88 0.13
89 0.11
90 0.11
91 0.1
92 0.13
93 0.12
94 0.12
95 0.11
96 0.09
97 0.09
98 0.07
99 0.07
100 0.05
101 0.09
102 0.09
103 0.11
104 0.12
105 0.12
106 0.14
107 0.19
108 0.21
109 0.23
110 0.25
111 0.27
112 0.27
113 0.28
114 0.3
115 0.28
116 0.26
117 0.23
118 0.2
119 0.2
120 0.19
121 0.18
122 0.15
123 0.13
124 0.12
125 0.12
126 0.13
127 0.1
128 0.1
129 0.12
130 0.12
131 0.12
132 0.15
133 0.15
134 0.14
135 0.14
136 0.15
137 0.12
138 0.12
139 0.11
140 0.09
141 0.12
142 0.16
143 0.21
144 0.29
145 0.37
146 0.39
147 0.46
148 0.52
149 0.59
150 0.65
151 0.71
152 0.73
153 0.76
154 0.83
155 0.86
156 0.82
157 0.76
158 0.75