Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8VV50

Protein Details
Accession A0A1S8VV50   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
13-34GIATLKRRNNGRSKKGRGHVNHBasic
NLS Segment(s)
PositionSequence
19-29RRNNGRSKKGR
Subcellular Location(s) nucl 11, cyto_nucl 10.5, cyto 8, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MDIMDCFQNIPSGIATLKRRNNGRSKKGRGHVNHVRCSNCSRCVPKDKAIKRFLIRNMVEAAAVSDIAGASVFTEYALPKLYIKTLYCISCAIHAHIVRVRSRVGRRDRTPPQRFRAFNKGAQNKTKSATATKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.24
3 0.31
4 0.36
5 0.42
6 0.47
7 0.54
8 0.64
9 0.68
10 0.73
11 0.75
12 0.78
13 0.81
14 0.82
15 0.84
16 0.78
17 0.77
18 0.77
19 0.75
20 0.73
21 0.68
22 0.63
23 0.56
24 0.57
25 0.52
26 0.47
27 0.45
28 0.43
29 0.45
30 0.52
31 0.54
32 0.56
33 0.62
34 0.63
35 0.66
36 0.65
37 0.65
38 0.58
39 0.6
40 0.56
41 0.55
42 0.48
43 0.4
44 0.37
45 0.31
46 0.28
47 0.21
48 0.17
49 0.08
50 0.07
51 0.05
52 0.03
53 0.03
54 0.03
55 0.03
56 0.02
57 0.02
58 0.02
59 0.03
60 0.03
61 0.04
62 0.04
63 0.05
64 0.06
65 0.06
66 0.07
67 0.08
68 0.09
69 0.12
70 0.12
71 0.14
72 0.17
73 0.18
74 0.18
75 0.18
76 0.17
77 0.18
78 0.19
79 0.18
80 0.19
81 0.19
82 0.21
83 0.22
84 0.25
85 0.24
86 0.24
87 0.25
88 0.27
89 0.33
90 0.39
91 0.46
92 0.53
93 0.55
94 0.64
95 0.72
96 0.76
97 0.8
98 0.8
99 0.79
100 0.79
101 0.78
102 0.75
103 0.76
104 0.7
105 0.67
106 0.69
107 0.7
108 0.68
109 0.73
110 0.7
111 0.63
112 0.61
113 0.58
114 0.51