Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8W1E1

Protein Details
Accession A0A1S8W1E1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
51-76WKEQKLKFSTWRKQRYERKAERAAYRHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 27
Family & Domain DBs
Amino Acid Sequences MKPSLILFSVLGLLLPANVLAIPIPGSTLGSAANPAVQEPTLVKRGIKLWWKEQKLKFSTWRKQRYERKAERAAYRNSINQQELDKQLVKDGYGELQSIPGQDGFPVDRPDQMIGGVPPLPLPIDGPIPVDDISDGDGKDPGYDSSNGLSDIDNGPGYDSDSSLPVASLGTSPSYGLDKSLPIIPGPIGGPIGGPSSYNSNNMAAGLSPGIGAHDLSLGNLRRNKNGIGFCVPRHSILPIGGPGSPGYNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.05
10 0.05
11 0.06
12 0.06
13 0.07
14 0.07
15 0.07
16 0.07
17 0.07
18 0.08
19 0.08
20 0.09
21 0.08
22 0.09
23 0.1
24 0.09
25 0.09
26 0.11
27 0.15
28 0.17
29 0.18
30 0.18
31 0.19
32 0.22
33 0.28
34 0.34
35 0.35
36 0.42
37 0.51
38 0.58
39 0.65
40 0.68
41 0.71
42 0.67
43 0.68
44 0.68
45 0.68
46 0.71
47 0.72
48 0.76
49 0.74
50 0.8
51 0.84
52 0.85
53 0.86
54 0.86
55 0.84
56 0.83
57 0.82
58 0.8
59 0.77
60 0.71
61 0.65
62 0.58
63 0.53
64 0.48
65 0.46
66 0.39
67 0.34
68 0.31
69 0.3
70 0.29
71 0.28
72 0.27
73 0.22
74 0.24
75 0.22
76 0.2
77 0.17
78 0.15
79 0.13
80 0.11
81 0.11
82 0.09
83 0.09
84 0.1
85 0.09
86 0.09
87 0.08
88 0.07
89 0.06
90 0.07
91 0.07
92 0.1
93 0.12
94 0.12
95 0.13
96 0.14
97 0.14
98 0.13
99 0.12
100 0.11
101 0.08
102 0.08
103 0.08
104 0.07
105 0.06
106 0.06
107 0.06
108 0.05
109 0.06
110 0.05
111 0.06
112 0.06
113 0.07
114 0.07
115 0.08
116 0.08
117 0.08
118 0.07
119 0.06
120 0.08
121 0.08
122 0.07
123 0.07
124 0.07
125 0.07
126 0.08
127 0.08
128 0.07
129 0.08
130 0.09
131 0.09
132 0.1
133 0.1
134 0.1
135 0.1
136 0.1
137 0.09
138 0.09
139 0.1
140 0.09
141 0.08
142 0.08
143 0.08
144 0.09
145 0.07
146 0.07
147 0.06
148 0.07
149 0.08
150 0.07
151 0.07
152 0.06
153 0.06
154 0.06
155 0.05
156 0.05
157 0.06
158 0.06
159 0.06
160 0.07
161 0.08
162 0.08
163 0.09
164 0.09
165 0.09
166 0.1
167 0.13
168 0.13
169 0.11
170 0.12
171 0.11
172 0.12
173 0.12
174 0.11
175 0.08
176 0.07
177 0.07
178 0.07
179 0.09
180 0.07
181 0.08
182 0.08
183 0.14
184 0.15
185 0.17
186 0.18
187 0.17
188 0.17
189 0.17
190 0.16
191 0.11
192 0.1
193 0.09
194 0.07
195 0.06
196 0.06
197 0.06
198 0.06
199 0.06
200 0.05
201 0.07
202 0.06
203 0.07
204 0.13
205 0.15
206 0.21
207 0.27
208 0.29
209 0.33
210 0.36
211 0.38
212 0.4
213 0.42
214 0.41
215 0.43
216 0.44
217 0.41
218 0.46
219 0.45
220 0.39
221 0.37
222 0.33
223 0.28
224 0.26
225 0.28
226 0.22
227 0.23
228 0.21
229 0.21
230 0.19