Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8VHI4

Protein Details
Accession A0A1S8VHI4   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
232-256ILDNRDIKPRGRKRKKTGEPLLSNEHydrophilic
NLS Segment(s)
PositionSequence
239-247KPRGRKRKK
Subcellular Location(s) nucl 14.5, cyto_nucl 10, cyto 4.5, plas 4, mito 1, pero 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR040202  Brl1/Brr6  
Gene Ontology GO:0016020  C:membrane  
GO:0005635  C:nuclear envelope  
GO:0006998  P:nuclear envelope organization  
Amino Acid Sequences MATNAHSPVSDLSPSGRRTKGQEWPSTRIRPSSLQASRGTESPMDFEMASDLAPDERSPWLLAVAMLTTPTKKKQLNQSPFQSPLPPSHSALSTVHPTTFSKPATRGGLGAASYIQPISAPFLPSQFGSTSFGQTRAGDLFSSTGISSTKDIFQFGMSSPTQKQQQQQQQQQHYQSHLHRKQSPIKKQPISSISQSLIKTAKPHDGALPPHRIKTFEIPANGFSPKKCDPMILDNRDIKPRGRKRKKTGEPLLSNENSVDNHSEYNSKSISPVRGPSYHYMHLPYLITGYIQVAFTFFIVCIVAYILVQLIASVRHDLQMKADEFSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.34
3 0.35
4 0.35
5 0.41
6 0.48
7 0.53
8 0.55
9 0.61
10 0.61
11 0.65
12 0.71
13 0.72
14 0.67
15 0.62
16 0.57
17 0.52
18 0.5
19 0.53
20 0.49
21 0.47
22 0.48
23 0.49
24 0.47
25 0.43
26 0.41
27 0.32
28 0.28
29 0.25
30 0.22
31 0.18
32 0.16
33 0.15
34 0.14
35 0.12
36 0.11
37 0.09
38 0.08
39 0.07
40 0.08
41 0.08
42 0.08
43 0.09
44 0.11
45 0.11
46 0.11
47 0.11
48 0.11
49 0.11
50 0.09
51 0.09
52 0.07
53 0.08
54 0.08
55 0.1
56 0.12
57 0.16
58 0.23
59 0.25
60 0.31
61 0.42
62 0.52
63 0.59
64 0.65
65 0.69
66 0.67
67 0.68
68 0.63
69 0.56
70 0.47
71 0.43
72 0.4
73 0.36
74 0.32
75 0.3
76 0.29
77 0.27
78 0.27
79 0.24
80 0.23
81 0.21
82 0.2
83 0.19
84 0.2
85 0.21
86 0.25
87 0.24
88 0.23
89 0.23
90 0.28
91 0.3
92 0.29
93 0.25
94 0.21
95 0.21
96 0.18
97 0.16
98 0.12
99 0.09
100 0.09
101 0.08
102 0.07
103 0.05
104 0.05
105 0.08
106 0.09
107 0.1
108 0.1
109 0.11
110 0.12
111 0.12
112 0.14
113 0.11
114 0.11
115 0.14
116 0.14
117 0.17
118 0.17
119 0.17
120 0.17
121 0.16
122 0.16
123 0.13
124 0.13
125 0.1
126 0.09
127 0.09
128 0.07
129 0.08
130 0.07
131 0.06
132 0.06
133 0.07
134 0.08
135 0.08
136 0.11
137 0.1
138 0.11
139 0.1
140 0.1
141 0.11
142 0.1
143 0.13
144 0.11
145 0.13
146 0.13
147 0.17
148 0.2
149 0.22
150 0.25
151 0.29
152 0.39
153 0.46
154 0.53
155 0.57
156 0.6
157 0.63
158 0.65
159 0.58
160 0.51
161 0.48
162 0.46
163 0.48
164 0.47
165 0.47
166 0.46
167 0.5
168 0.57
169 0.61
170 0.66
171 0.64
172 0.69
173 0.67
174 0.65
175 0.66
176 0.61
177 0.55
178 0.47
179 0.41
180 0.33
181 0.33
182 0.32
183 0.27
184 0.24
185 0.21
186 0.21
187 0.2
188 0.24
189 0.21
190 0.22
191 0.23
192 0.27
193 0.31
194 0.34
195 0.42
196 0.37
197 0.39
198 0.39
199 0.36
200 0.34
201 0.36
202 0.37
203 0.32
204 0.34
205 0.32
206 0.33
207 0.33
208 0.33
209 0.27
210 0.2
211 0.23
212 0.22
213 0.24
214 0.23
215 0.22
216 0.23
217 0.33
218 0.43
219 0.42
220 0.45
221 0.48
222 0.5
223 0.54
224 0.52
225 0.46
226 0.47
227 0.52
228 0.58
229 0.63
230 0.71
231 0.76
232 0.86
233 0.91
234 0.91
235 0.91
236 0.9
237 0.85
238 0.8
239 0.78
240 0.67
241 0.58
242 0.47
243 0.39
244 0.29
245 0.24
246 0.22
247 0.14
248 0.15
249 0.15
250 0.18
251 0.17
252 0.2
253 0.19
254 0.17
255 0.19
256 0.22
257 0.26
258 0.27
259 0.31
260 0.33
261 0.35
262 0.39
263 0.42
264 0.44
265 0.42
266 0.4
267 0.38
268 0.34
269 0.34
270 0.3
271 0.24
272 0.19
273 0.16
274 0.14
275 0.11
276 0.11
277 0.1
278 0.09
279 0.09
280 0.08
281 0.09
282 0.09
283 0.09
284 0.07
285 0.07
286 0.07
287 0.07
288 0.06
289 0.07
290 0.07
291 0.06
292 0.06
293 0.06
294 0.06
295 0.05
296 0.05
297 0.05
298 0.06
299 0.08
300 0.11
301 0.11
302 0.15
303 0.17
304 0.18
305 0.21
306 0.28
307 0.28