Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8VAV0

Protein Details
Accession A0A1S8VAV0   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
90-146VMHNRKELNRKRKKMSPPPKKHPPKMERKSQKKKKSPLPKKHPPKVERKSQKKMMALBasic
NLS Segment(s)
PositionSequence
80-84KKDPR
88-142RVVMHNRKELNRKRKKMSPPPKKHPPKMERKSQKKKKSPLPKKHPPKVERKSQKK
Subcellular Location(s) nucl 18, mito 8
Family & Domain DBs
Amino Acid Sequences LKPKTQINPNTQIKTQIKIIPKTQTKINPKTQPQIKIQLLVVHLRGHGYQKNFRVFQVQWARQPLQQLQVLPLVLLLPKKKDPRNLVRVVMHNRKELNRKRKKMSPPPKKHPPKMERKSQKKKKSPLPKKHPPKVERKSQKKMMALLMMILNKVHFKKISD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.53
3 0.49
4 0.48
5 0.48
6 0.52
7 0.52
8 0.56
9 0.55
10 0.57
11 0.6
12 0.62
13 0.65
14 0.7
15 0.7
16 0.69
17 0.76
18 0.75
19 0.73
20 0.68
21 0.69
22 0.61
23 0.54
24 0.5
25 0.43
26 0.38
27 0.34
28 0.29
29 0.21
30 0.19
31 0.17
32 0.17
33 0.17
34 0.19
35 0.22
36 0.27
37 0.31
38 0.38
39 0.37
40 0.37
41 0.39
42 0.35
43 0.4
44 0.44
45 0.41
46 0.39
47 0.44
48 0.45
49 0.4
50 0.43
51 0.35
52 0.3
53 0.28
54 0.24
55 0.2
56 0.2
57 0.19
58 0.15
59 0.13
60 0.09
61 0.08
62 0.09
63 0.08
64 0.09
65 0.15
66 0.21
67 0.24
68 0.31
69 0.38
70 0.45
71 0.53
72 0.55
73 0.54
74 0.51
75 0.55
76 0.56
77 0.56
78 0.5
79 0.45
80 0.43
81 0.44
82 0.5
83 0.53
84 0.57
85 0.59
86 0.64
87 0.67
88 0.74
89 0.8
90 0.81
91 0.83
92 0.83
93 0.83
94 0.85
95 0.9
96 0.92
97 0.89
98 0.89
99 0.87
100 0.87
101 0.85
102 0.86
103 0.86
104 0.87
105 0.91
106 0.9
107 0.91
108 0.9
109 0.91
110 0.91
111 0.91
112 0.91
113 0.91
114 0.91
115 0.91
116 0.92
117 0.92
118 0.92
119 0.88
120 0.88
121 0.86
122 0.87
123 0.87
124 0.86
125 0.87
126 0.86
127 0.86
128 0.8
129 0.75
130 0.7
131 0.63
132 0.53
133 0.45
134 0.39
135 0.32
136 0.27
137 0.22
138 0.18
139 0.19
140 0.2
141 0.22