Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8W3F5

Protein Details
Accession A0A1S8W3F5    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MRDKWRKKRQRRLKRKRRKMRARSKPGCLIVBasic
NLS Segment(s)
PositionSequence
4-25KWRKKRQRRLKRKRRKMRARSK
Subcellular Location(s) nucl 15, mito_nucl 13.666, mito 10, cyto_nucl 9.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MRDKWRKKRQRRLKRKRRKMRARSKPGCLIVTRYLGPLKTDSLGFKSVSSSNMTKQRIRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.97
3 0.97
4 0.97
5 0.97
6 0.97
7 0.96
8 0.96
9 0.96
10 0.92
11 0.87
12 0.83
13 0.75
14 0.67
15 0.56
16 0.49
17 0.4
18 0.36
19 0.29
20 0.23
21 0.2
22 0.18
23 0.18
24 0.15
25 0.14
26 0.12
27 0.13
28 0.13
29 0.15
30 0.17
31 0.17
32 0.16
33 0.17
34 0.18
35 0.18
36 0.22
37 0.21
38 0.26
39 0.35
40 0.39