Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8VZU8

Protein Details
Accession A0A1S8VZU8    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAGAKKKWSKGRVKDKANNAVVFHydrophilic
NLS Segment(s)
PositionSequence
6-12KKWSKGR
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAGAKKKWSKGRVKDKANNAVVFDKPTYEKLYKEVPTFKLVTTSILVDRLRINGALARAAIRELETQGLIRKVSSHGSQGIYTRATKGEEADEETKEKAPAAKAVEAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.87
4 0.83
5 0.74
6 0.65
7 0.58
8 0.49
9 0.43
10 0.34
11 0.26
12 0.22
13 0.22
14 0.25
15 0.23
16 0.23
17 0.23
18 0.3
19 0.31
20 0.34
21 0.37
22 0.33
23 0.35
24 0.36
25 0.32
26 0.28
27 0.25
28 0.23
29 0.18
30 0.17
31 0.13
32 0.16
33 0.16
34 0.13
35 0.14
36 0.13
37 0.12
38 0.11
39 0.11
40 0.08
41 0.09
42 0.08
43 0.08
44 0.07
45 0.07
46 0.07
47 0.07
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.08
54 0.1
55 0.11
56 0.1
57 0.1
58 0.1
59 0.11
60 0.14
61 0.15
62 0.16
63 0.18
64 0.19
65 0.21
66 0.21
67 0.22
68 0.21
69 0.2
70 0.19
71 0.17
72 0.17
73 0.17
74 0.17
75 0.18
76 0.17
77 0.23
78 0.24
79 0.24
80 0.24
81 0.26
82 0.26
83 0.23
84 0.22
85 0.2
86 0.2
87 0.23
88 0.26
89 0.28