Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8VCL3

Protein Details
Accession A0A1S8VCL3    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
123-167EPTPNETPKPTPKPKPKPRSRFGPGVKPRPKRKPRSTPTPTPIFNHydrophilic
NLS Segment(s)
PositionSequence
131-157KPTPKPKPKPRSRFGPGVKPRPKRKPR
Subcellular Location(s) nucl 4plas 4pero 4E.R. 4, cyto 3, extr 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MKLSAFSLIAMFMVTANALVIPMDSTDDASGLVKRQSPNPTEDPTLKPTDDPVLNRAFFSTPTNEPKPRPTDEPTPNITPRSTPTNKLKLRPTDEPTPNETPVLKFTPTPPAGLPLNSKPTDEPTPNETPKPTPKPKPKPRSRFGPGVKPRPKRKPRSTPTPTPIFNAIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.06
11 0.06
12 0.07
13 0.07
14 0.08
15 0.08
16 0.09
17 0.1
18 0.1
19 0.12
20 0.15
21 0.17
22 0.23
23 0.29
24 0.31
25 0.36
26 0.39
27 0.41
28 0.42
29 0.44
30 0.42
31 0.4
32 0.41
33 0.35
34 0.31
35 0.28
36 0.29
37 0.28
38 0.25
39 0.24
40 0.26
41 0.26
42 0.25
43 0.25
44 0.2
45 0.18
46 0.19
47 0.19
48 0.18
49 0.25
50 0.31
51 0.33
52 0.34
53 0.39
54 0.42
55 0.41
56 0.42
57 0.4
58 0.44
59 0.47
60 0.5
61 0.48
62 0.48
63 0.46
64 0.42
65 0.37
66 0.29
67 0.25
68 0.29
69 0.26
70 0.27
71 0.33
72 0.42
73 0.44
74 0.48
75 0.53
76 0.51
77 0.54
78 0.55
79 0.53
80 0.52
81 0.54
82 0.53
83 0.52
84 0.49
85 0.44
86 0.38
87 0.34
88 0.25
89 0.24
90 0.23
91 0.18
92 0.15
93 0.16
94 0.24
95 0.24
96 0.25
97 0.21
98 0.22
99 0.23
100 0.24
101 0.26
102 0.21
103 0.27
104 0.26
105 0.27
106 0.24
107 0.28
108 0.32
109 0.31
110 0.3
111 0.3
112 0.38
113 0.4
114 0.41
115 0.38
116 0.38
117 0.46
118 0.52
119 0.55
120 0.57
121 0.65
122 0.75
123 0.84
124 0.89
125 0.9
126 0.91
127 0.9
128 0.9
129 0.85
130 0.85
131 0.81
132 0.8
133 0.79
134 0.8
135 0.82
136 0.81
137 0.85
138 0.86
139 0.89
140 0.89
141 0.9
142 0.91
143 0.91
144 0.92
145 0.91
146 0.91
147 0.88
148 0.86
149 0.77
150 0.7