Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8VYY4

Protein Details
Accession A0A1S8VYY4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKSGKKPQSRAKMVLDKEBasic
NLS Segment(s)
PositionSequence
3-10KRKSGKKP
Subcellular Location(s) mito 21.5, mito_nucl 12.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSGKKPQSRAKMVLDKEFSCLFCNHEKTVTAKIDMENKIGQLTCSACGVSFQTMVTSLSEPVDVYSDWIDACELANEGQKTTMPSAPTYSSKKRYTNEVDDDDDDEDDDADLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.73
4 0.71
5 0.65
6 0.55
7 0.51
8 0.47
9 0.39
10 0.32
11 0.29
12 0.25
13 0.27
14 0.3
15 0.27
16 0.27
17 0.28
18 0.28
19 0.34
20 0.33
21 0.27
22 0.25
23 0.25
24 0.31
25 0.3
26 0.3
27 0.23
28 0.21
29 0.21
30 0.2
31 0.17
32 0.12
33 0.11
34 0.09
35 0.09
36 0.09
37 0.07
38 0.08
39 0.09
40 0.08
41 0.07
42 0.06
43 0.06
44 0.07
45 0.07
46 0.08
47 0.07
48 0.07
49 0.06
50 0.07
51 0.06
52 0.06
53 0.07
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.1
67 0.1
68 0.1
69 0.11
70 0.11
71 0.13
72 0.15
73 0.17
74 0.15
75 0.16
76 0.19
77 0.22
78 0.26
79 0.32
80 0.37
81 0.43
82 0.48
83 0.54
84 0.53
85 0.59
86 0.62
87 0.64
88 0.64
89 0.61
90 0.58
91 0.53
92 0.53
93 0.45
94 0.36
95 0.28
96 0.2
97 0.15