Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8VVD7

Protein Details
Accession A0A1S8VVD7    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
31-55TPSLPPPPKTAKKKHNKIQRIEYKVHydrophilic
NLS Segment(s)
PositionSequence
41-44AKKK
Subcellular Location(s) mito 18.5, mito_nucl 13.5, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MHGHVMRKGHFHTIDLCLSRSHNLLSMNNNTPSLPPPPKTAKKKHNKIQRIEYKVNTRTCTNSYMTRTDMFGYNIHAHIYTWLDIEYCIYIYPTICIYNNPKTVEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.32
4 0.26
5 0.26
6 0.26
7 0.24
8 0.2
9 0.18
10 0.19
11 0.21
12 0.25
13 0.29
14 0.32
15 0.32
16 0.31
17 0.28
18 0.26
19 0.25
20 0.27
21 0.26
22 0.23
23 0.28
24 0.36
25 0.45
26 0.53
27 0.61
28 0.64
29 0.71
30 0.79
31 0.82
32 0.84
33 0.83
34 0.81
35 0.82
36 0.81
37 0.78
38 0.72
39 0.67
40 0.64
41 0.62
42 0.59
43 0.5
44 0.42
45 0.37
46 0.34
47 0.34
48 0.28
49 0.27
50 0.27
51 0.28
52 0.29
53 0.26
54 0.25
55 0.23
56 0.22
57 0.19
58 0.16
59 0.17
60 0.17
61 0.17
62 0.17
63 0.15
64 0.14
65 0.14
66 0.15
67 0.12
68 0.1
69 0.1
70 0.09
71 0.09
72 0.1
73 0.09
74 0.08
75 0.07
76 0.07
77 0.08
78 0.08
79 0.09
80 0.1
81 0.12
82 0.12
83 0.17
84 0.23
85 0.31
86 0.37