Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8VAX0

Protein Details
Accession A0A1S8VAX0    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
72-91DDFPKKYDLRPRRYNRQIKIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10, cyto 5.5, mito 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004835  Chitin_synth  
IPR013616  Chitin_synth_N  
Gene Ontology GO:0016020  C:membrane  
GO:0004100  F:chitin synthase activity  
Pfam View protein in Pfam  
PF08407  Chitin_synth_1N  
Amino Acid Sequences MSYWPASFLGGKQDSANDTIARYSKKNIQANPGSGNFVLTLPVSKQLLKDAAYQTGEEFTHMSYTAATCDPDDFPKKYDLRPRRYNRQIKIALVVTMYNEDDGLFIKSLLAAQKNIAYLCSDQCPYSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.26
4 0.17
5 0.16
6 0.18
7 0.22
8 0.23
9 0.23
10 0.25
11 0.31
12 0.4
13 0.46
14 0.46
15 0.51
16 0.54
17 0.55
18 0.56
19 0.49
20 0.42
21 0.35
22 0.33
23 0.24
24 0.18
25 0.15
26 0.1
27 0.09
28 0.07
29 0.11
30 0.11
31 0.11
32 0.11
33 0.13
34 0.15
35 0.16
36 0.2
37 0.18
38 0.21
39 0.21
40 0.2
41 0.18
42 0.18
43 0.16
44 0.12
45 0.11
46 0.07
47 0.07
48 0.07
49 0.07
50 0.05
51 0.06
52 0.06
53 0.07
54 0.07
55 0.06
56 0.07
57 0.08
58 0.12
59 0.16
60 0.16
61 0.17
62 0.23
63 0.25
64 0.28
65 0.38
66 0.44
67 0.49
68 0.58
69 0.64
70 0.69
71 0.78
72 0.82
73 0.77
74 0.78
75 0.73
76 0.64
77 0.61
78 0.51
79 0.41
80 0.33
81 0.28
82 0.19
83 0.16
84 0.15
85 0.1
86 0.08
87 0.07
88 0.07
89 0.08
90 0.09
91 0.08
92 0.07
93 0.07
94 0.08
95 0.09
96 0.13
97 0.14
98 0.13
99 0.15
100 0.17
101 0.19
102 0.19
103 0.18
104 0.17
105 0.17
106 0.19
107 0.22
108 0.21