Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8W4H6

Protein Details
Accession A0A1S8W4H6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
108-130LASTPSKLKVEKKKSKKAGSKWAHydrophilic
NLS Segment(s)
PositionSequence
114-130KLKVEKKKSKKAGSKWA
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MATTFVAPETTPLHLRILSRSRPQLASIITSVEAFHIEAQNASQNHAITARSSQLLPSTAFQLVQLSAAIAWEQTARPSSAPLYLAEKHTHRNRTSADTTTAAAAGSLASTPSKLKVEKKKSKKAGSKWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.27
4 0.33
5 0.36
6 0.42
7 0.46
8 0.48
9 0.47
10 0.48
11 0.44
12 0.38
13 0.34
14 0.27
15 0.23
16 0.19
17 0.18
18 0.16
19 0.12
20 0.11
21 0.08
22 0.09
23 0.08
24 0.08
25 0.08
26 0.09
27 0.14
28 0.13
29 0.15
30 0.15
31 0.14
32 0.14
33 0.16
34 0.15
35 0.1
36 0.12
37 0.11
38 0.1
39 0.1
40 0.1
41 0.1
42 0.12
43 0.12
44 0.11
45 0.12
46 0.11
47 0.11
48 0.11
49 0.1
50 0.08
51 0.08
52 0.07
53 0.04
54 0.04
55 0.04
56 0.04
57 0.03
58 0.03
59 0.04
60 0.04
61 0.05
62 0.06
63 0.07
64 0.07
65 0.08
66 0.09
67 0.1
68 0.11
69 0.11
70 0.15
71 0.16
72 0.19
73 0.21
74 0.22
75 0.28
76 0.34
77 0.41
78 0.37
79 0.41
80 0.42
81 0.46
82 0.49
83 0.44
84 0.41
85 0.34
86 0.34
87 0.29
88 0.26
89 0.18
90 0.14
91 0.1
92 0.06
93 0.05
94 0.04
95 0.05
96 0.05
97 0.06
98 0.07
99 0.1
100 0.15
101 0.2
102 0.29
103 0.39
104 0.5
105 0.6
106 0.7
107 0.78
108 0.84
109 0.9
110 0.91