Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B7XN94

Protein Details
Accession B7XN94   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
8-28KFESCPFRKWWKHSARFYWHIHydrophilic
131-152TNCSDKCKAVNCCKRNKTGKCQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 10.833, cyto_nucl 10.333, mito 6.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MCLTSELKFESCPFRKWWKHSARFYWHIYPTTNQTHIDKINNYLATVQQNINNVKKVNDINLDAFIFDETKLQESVSSEESEDCCCCDCNFQPSPLLQGTPIPMGSTIPLAGNFGGNRYSCVNIDCSPQTTNCSDKCKAVNCCKRNKTGKCQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.53
3 0.58
4 0.66
5 0.67
6 0.72
7 0.78
8 0.82
9 0.8
10 0.78
11 0.78
12 0.75
13 0.68
14 0.61
15 0.54
16 0.47
17 0.45
18 0.44
19 0.4
20 0.35
21 0.32
22 0.34
23 0.34
24 0.36
25 0.31
26 0.29
27 0.33
28 0.31
29 0.29
30 0.25
31 0.24
32 0.22
33 0.23
34 0.2
35 0.16
36 0.21
37 0.25
38 0.26
39 0.27
40 0.26
41 0.24
42 0.27
43 0.25
44 0.24
45 0.23
46 0.22
47 0.2
48 0.21
49 0.2
50 0.16
51 0.15
52 0.12
53 0.09
54 0.07
55 0.07
56 0.06
57 0.07
58 0.07
59 0.07
60 0.08
61 0.08
62 0.1
63 0.1
64 0.1
65 0.09
66 0.1
67 0.11
68 0.12
69 0.11
70 0.09
71 0.08
72 0.09
73 0.09
74 0.11
75 0.12
76 0.17
77 0.19
78 0.2
79 0.21
80 0.2
81 0.24
82 0.21
83 0.2
84 0.14
85 0.13
86 0.14
87 0.13
88 0.12
89 0.09
90 0.09
91 0.08
92 0.09
93 0.08
94 0.07
95 0.06
96 0.07
97 0.07
98 0.07
99 0.09
100 0.08
101 0.09
102 0.11
103 0.11
104 0.13
105 0.14
106 0.16
107 0.15
108 0.16
109 0.19
110 0.17
111 0.22
112 0.22
113 0.23
114 0.23
115 0.24
116 0.26
117 0.26
118 0.3
119 0.31
120 0.36
121 0.35
122 0.39
123 0.44
124 0.48
125 0.54
126 0.6
127 0.65
128 0.66
129 0.75
130 0.77
131 0.81
132 0.84