Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8VIP5

Protein Details
Accession A0A1S8VIP5    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
93-131VRKGLSEAKKTNRKQRKEKKNRAKKFRGTKKAKASAAKKBasic
NLS Segment(s)
PositionSequence
93-131VRKGLSEAKKTNRKQRKEKKNRAKKFRGTKKAKASAAKK
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MAADTVTIRTRKFLTNRLLQRKQMVVDVIHPGSPNVAKSELSSKIASLYKADAQCTFVFGVKTAFGGGKSTGFAVIYDTMDAAMKFEPKYRLVRKGLSEAKKTNRKQRKEKKNRAKKFRGTKKAKASAAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.61
4 0.68
5 0.72
6 0.68
7 0.68
8 0.64
9 0.57
10 0.5
11 0.42
12 0.33
13 0.29
14 0.31
15 0.26
16 0.23
17 0.22
18 0.18
19 0.18
20 0.18
21 0.16
22 0.12
23 0.13
24 0.12
25 0.13
26 0.18
27 0.19
28 0.21
29 0.2
30 0.18
31 0.21
32 0.22
33 0.21
34 0.17
35 0.17
36 0.19
37 0.2
38 0.21
39 0.17
40 0.18
41 0.18
42 0.18
43 0.16
44 0.13
45 0.11
46 0.11
47 0.11
48 0.08
49 0.08
50 0.07
51 0.07
52 0.06
53 0.07
54 0.07
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.06
70 0.06
71 0.08
72 0.08
73 0.12
74 0.15
75 0.18
76 0.27
77 0.31
78 0.39
79 0.41
80 0.46
81 0.45
82 0.52
83 0.58
84 0.56
85 0.58
86 0.56
87 0.62
88 0.67
89 0.7
90 0.72
91 0.73
92 0.76
93 0.81
94 0.84
95 0.86
96 0.88
97 0.93
98 0.94
99 0.95
100 0.96
101 0.95
102 0.95
103 0.94
104 0.94
105 0.94
106 0.93
107 0.91
108 0.9
109 0.9
110 0.89
111 0.86