Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B7XM61

Protein Details
Accession B7XM61    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
47-67RENSLKKKRVCKTPKISQKKGBasic
72-99LTLRGEKEKKPPPPTKKKNTPLLSPPSGHydrophilic
NLS Segment(s)
PositionSequence
42-90EKKIPRENSLKKKRVCKTPKISQKKGGVPPLTLRGEKEKKPPPPTKKKN
Subcellular Location(s) mito_nucl 13.333, nucl 13, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MASSQTPFKKLHPPWILQKSPQKSPIPKKNFFFPAAFKTFGEKKIPRENSLKKKRVCKTPKISQKKGGVPPLTLRGEKEKKPPPPTKKKNTPLLSPPSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.66
3 0.66
4 0.63
5 0.69
6 0.64
7 0.64
8 0.66
9 0.64
10 0.64
11 0.71
12 0.74
13 0.73
14 0.74
15 0.71
16 0.71
17 0.68
18 0.61
19 0.53
20 0.46
21 0.44
22 0.41
23 0.39
24 0.31
25 0.31
26 0.31
27 0.31
28 0.35
29 0.31
30 0.33
31 0.41
32 0.44
33 0.43
34 0.49
35 0.55
36 0.59
37 0.67
38 0.69
39 0.64
40 0.71
41 0.73
42 0.75
43 0.74
44 0.73
45 0.72
46 0.74
47 0.8
48 0.81
49 0.8
50 0.77
51 0.77
52 0.75
53 0.72
54 0.7
55 0.61
56 0.53
57 0.51
58 0.5
59 0.46
60 0.38
61 0.34
62 0.36
63 0.4
64 0.43
65 0.49
66 0.5
67 0.56
68 0.65
69 0.74
70 0.75
71 0.8
72 0.86
73 0.88
74 0.9
75 0.9
76 0.91
77 0.87
78 0.84
79 0.82