Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8WA13

Protein Details
Accession A0A1S8WA13    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
90-111NGDDTKKTPKQPKKVSVWGFISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9plas 9, golg 4, cyto 2, extr 1, cyto_nucl 1, pero 1, E.R. 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009542  Spc1/SPCS1  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06645  SPC12  
Amino Acid Sequences MNILQSGKIDFHGQRLADKYSTAILTLTGVVGFVAGFATDSVLNTVIVDAVGLVLTCLICLPAWPMYNTHPVKWLEKEMPLTSDDDGSDNGDDTKKTPKQPKKVSVWGFISRILF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.32
4 0.27
5 0.27
6 0.24
7 0.21
8 0.21
9 0.17
10 0.13
11 0.1
12 0.1
13 0.1
14 0.09
15 0.06
16 0.05
17 0.05
18 0.04
19 0.04
20 0.03
21 0.03
22 0.02
23 0.03
24 0.03
25 0.04
26 0.04
27 0.04
28 0.05
29 0.06
30 0.06
31 0.05
32 0.06
33 0.04
34 0.04
35 0.04
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.03
48 0.04
49 0.07
50 0.08
51 0.09
52 0.1
53 0.13
54 0.23
55 0.24
56 0.23
57 0.26
58 0.27
59 0.3
60 0.31
61 0.33
62 0.26
63 0.28
64 0.31
65 0.26
66 0.26
67 0.24
68 0.23
69 0.19
70 0.17
71 0.15
72 0.12
73 0.11
74 0.11
75 0.11
76 0.1
77 0.11
78 0.11
79 0.11
80 0.11
81 0.21
82 0.24
83 0.33
84 0.43
85 0.51
86 0.61
87 0.71
88 0.79
89 0.79
90 0.84
91 0.82
92 0.8
93 0.77
94 0.72
95 0.64